Identifiers and Description

Gene Model Identifier

Contig18999.0.g66

Standard Name

SUB2b

Aliases

Contig18999_0_g66

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam04851 ) Type III restriction enzyme, res subunit
  • ( pfam00580 ) UvrD/REP helicase N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL084W1.9999987447608204e-178SUB2 SGDID:S000002242, Chr IV
from 305237-306577, Genom...
T. thermophilaTTHERM_004693802.9995941501461703e-129DEAD/DEAH box helicase family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18999.0.g66(coding)
ATGGCAGACTTAAACTAACTTCCAGATTACGATTACGATGTTGATCAACCTGGATTTGGC
GAAGATCAAAATCAGATGAATTAAGGATATGGGTAGTAAGGCAATTACTTTTAGTAGAGC
AAGCCTTTGATGTATTCAGGAATAAACACATCTGGTTTCAAAGATTTCTTACTCAAGCCA
GAACTCTAAAGAGCAATTATTGAGTGTGGTTTCGAGCATCCATCTGAAGTCCAGTAAGAA
TGTATACCTTAGGCTTCTATGGGTGTAGACATCCTATGTTAAGCTAAATCAGGAATGGGA
AAAACAGCTGTCTTTGTATTAACTACCTTGCATCAACTAGATTAAGAACCTAAGCCATTG
ACAGTGCTGGTTTTATGTCACACCAGAGAGCTTGCTCATTAAATCAAAAAGGAGTATGAT
AGATTTACAAAATATCTAGATAAAGTATCGTGTGAAGTGATATATGGAGGTCAACCGATC
TAAACTCATCAGAAATTGCTGTAGGATAAGCCTCCTACTATTATTGTAGGAACACCTGGC
AGAACTTTAGCCCTAGTAAAATCATAGCACTTAAAATTCGAAAATCTCAAATACTTTGTG
CTTGATGAGTGTGATAAAATGCTTAGTGAACTTGATATGAGGCAAGATGTCCAATCTATT
TTCAAGATGACTCCTTATCAAAAGCAAGTTATGATGTTTTCAGCTACTTTAGGCTAAGAC
ATTAGAAAAGTCTGCAAAAAGTTCATGAAAAATCCATTTGAGATTTATATCGATAACGAT
ATTAAACTGACTCTTCATGGACTTCAATAATACACTGTAAAACTAGCTGAGGACTCTAAG
ACTAAGAAGCTTATAGAATTACTGGATTCTCTTCTATTCAATTAAGTAATAATATTTGTT
AAAACCTCGTAAAGAGCAGAGGCTTTAAGCAAACTATTACTCAAGCAAAACTTCCCTTCA
ACTTTTATTCATGGAGGATTGCCGCAAGATGAAAGGATTAAACGATTTCAAAATTTCAAA
GAATTTAAGCAACGAATCATGGTAGCAACTGATCTCTTCGGAAGAGGAATAGACATAGAG
AAAATTAACATAGTCTTTAACTATGACATGCCAGAGAGCTCTGACTAATACCTTCATAGA
GTGGCTAGAGCAGGAAGATTCGGTACCAAAGGACTCGCAATTAGTTTTGTCACAACTAAA
GAAGACAATGAAATACTAGAAGAGACTTAAAAGAGATTTGAAGTTAAAGTCGGTGAACTA
CCAAACTCAATCGATACTTCAACTTACATGAACTCATGA


>Contig18999.0.g66(protein)
MADLNQLPDYDYDVDQPGFGEDQNQMNQGYGQQGNYFQQSKPLMYSGINTSGFKDFLLKP
ELQRAIIECGFEHPSEVQQECIPQASMGVDILCQAKSGMGKTAVFVLTTLHQLDQEPKPL
TVLVLCHTRELAHQIKKEYDRFTKYLDKVSCEVIYGGQPIQTHQKLLQDKPPTIIVGTPG
RTLALVKSQHLKFENLKYFVLDECDKMLSELDMRQDVQSIFKMTPYQKQVMMFSATLGQD
IRKVCKKFMKNPFEIYIDNDIKLTLHGLQQYTVKLAEDSKTKKLIELLDSLLFNQVIIFV
KTSQRAEALSKLLLKQNFPSTFIHGGLPQDERIKRFQNFKEFKQRIMVATDLFGRGIDIE
KINIVFNYDMPESSDQYLHRVARAGRFGTKGLAISFVTTKEDNEILEETQKRFEVKVGEL
PNSIDTSTYMNS