Identifiers and Description

Gene Model Identifier

Contig10970.0.g31

Standard Name

SUB2a

Aliases

Contig10970_0_g31

Description

DEAD/DEAH box helicase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00270 ) DEAD/DEAH box helicase
  • ( pfam00271 ) Helicase conserved C-terminal domain
  • ( pfam04851 ) Type III restriction enzyme, res subunit
  • ( pfam13245 ) Part of AAA domain
  • ( pfam03323 ) Bacillus/Clostridium GerA spore germination protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL084W9.997093137033517e-262SUB2 SGDID:S000002242, Chr IV
from 305237-306577, Genom...
T. thermophilaTTHERM_004693803.0001046824819247e-131DEAD/DEAH box helicase family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10970.0.g31(coding)
ATGGCATAAAACAACATGGATATTCCCGACTACGAGTACGACATTGATGACAACAACGAA
GAAGAAAAGCAAAATGGTGCTGCTGGAAGAATGACTGCATACACTGGTGTCTTGTCAGCT
GGTTTCAAGGATCTTCTTTTGAAACCACAACTACAAAGAGCCATCACAGAATGCGGTTTT
GAGCATCCATCAGAGGTACAACAAGAGTGCATTCCTCAAGCAATGATTGGAGTTGATGTC
CTATGCCAAGCAAAGTCTGGTATGGGTAAAACGGCTGTCTTCGTTCTGACTATCTTACAT
TAGTTACCAGACGACCCAAAGCCCGTCTCCGCACTTATCCTTTGTCACACTAGAGAGCTC
GCTTATCAAATTAAGAACGAGTTCGCTAGATTCACTAGATATCTTCCAGATATTAGAACA
GAGGTTATTTACGGAGGATAACCCATCCAAGACCAAATTTAAATGCTTAAGGGCGTGAAA
CCTCCCCATATTGTTGTTGGAACCCCAGGCAGAATCAAGCATTTAGTGAACAAGAAGGAT
TTAGATCTCAGTGGACTTAAAATCTTTGTCCTAGACGAATGCGACAAAATGCTAGAAGAG
ACTGACATGCGCTCTGATGTGCAACAAATCTTTATGGCTACTCCCCATCAGAAGCAAGTT
TGTATGTTCTCAGCTACTCTCTCAACTGATGTGAAGAAAATTTGCAGAAGATTCATGAAG
AACCCATTTGAAATTTTCATTGACAACTAGAACAAACTCACTCTTCACGGTCTCAAGCAA
TACTACTTGAAACTAGAAGAGAACCAAAAGACTAAGAAGCTCACTGACCTTCTTGACTCA
CTCATGTTCAACTAAGTTATTGTATTCGTGAAAAGTGTCGACTTTGCAATCAAGCTTGAT
GAGATCTTGAGAAGAGACAACTTCCCATCTATCTCCATTCACAGAGATCTTGCTCAAGAT
GAAAGAATCAAGAGATACAACGAGTTCAAGCAGTTCAAGTACAGAATTATGGTTGCCACT
GACATCTTCGGAAGAGGTATCGATATTGAGAAGATCAACGTTGTCTTCAACTATAACATG
CCAAACGACTCAGACTCTTATCTTCACAGAGTAGGAAGAGCTGGTAGATTCGGAACAAAG
GGTCTCGCTATTACCTTCGTCTCTGGAGCTAAAGATTTGGAAGTCCTCGAGGAAATCCAA
AAGAGATTCGAAGTCAAGATTGAAGAACTTCCTCAGACCATTGATGTCTCAACTTACATG
AACAACTGA


>Contig10970.0.g31(protein)
MAQNNMDIPDYEYDIDDNNEEEKQNGAAGRMTAYTGVLSAGFKDLLLKPQLQRAITECGF
EHPSEVQQECIPQAMIGVDVLCQAKSGMGKTAVFVLTILHQLPDDPKPVSALILCHTREL
AYQIKNEFARFTRYLPDIRTEVIYGGQPIQDQIQMLKGVKPPHIVVGTPGRIKHLVNKKD
LDLSGLKIFVLDECDKMLEETDMRSDVQQIFMATPHQKQVCMFSATLSTDVKKICRRFMK
NPFEIFIDNQNKLTLHGLKQYYLKLEENQKTKKLTDLLDSLMFNQVIVFVKSVDFAIKLD
EILRRDNFPSISIHRDLAQDERIKRYNEFKQFKYRIMVATDIFGRGIDIEKINVVFNYNM
PNDSDSYLHRVGRAGRFGTKGLAITFVSGAKDLEVLEEIQKRFEVKIEELPQTIDVSTYM
NN