Identifiers and Description

Gene Model Identifier

Contig2932.0.g32

Standard Name

SUB1b

Aliases

Contig2932_0_g32

Description

Transcriptional Coactivator p15 (PC4)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02229 ) Transcriptional Coactivator p15 (PC4)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000461200.00000000009998509410508463Putative RNA polymerase II tra
nscriptional co...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2932.0.g32(coding)
ATGGATAGTGTATTTAAACGCAATCGTTACCAATAAAGTTATGGAAATGGCTATGATCGA
GGAGGTCAAAGCGGTGGAGGAGGTAGCTACAGAGGTGGCTCTAGTGGAGGAGGAGGATCT
TCTCAATACCGAAGAGGTGGATACAATGGAGGCGGAGGTGGATACAATGGAGGCGGAGGT
GGTGGAGGAGGCTTTAACAGGAATCAATATGGAAGATCGAGGTCGAGATTTGATAATCAA
TATAGAGGAAAATCTCAAGCAAGGGATGATGCTGGAGGTAGTAGCAGTGGCGGTGGATAT
GGAAGCACCTATTAATCTTAATAGTAGTCTTCTACTACTAGAAGTACTTTCCAACCACCA
GGATTTGAAGCGTACAGCTATAATCCTTAAAGTAGCAACAATAACAATAGCAATTCGAGT
GGCTATGGCAACAATTAATAGAATGGAGACAACAATTAAAACAATACTTAATAAACCTAG
TAAAAATTCCAGAGATAAGGAGACCCAGACGAAGAAGTGAAATAGTTTGAGTTAAGTGTG
AAGAAGAAGGTTCAAGTTAAGAGATATTATGGTGAAGTTTTTGTAGATTTAAGGGAATTT
TTCATCAAGGGAGAGAAATATCTGCCCACAAAAAAAGGAGTCACACTAAAAATGGACCAT
TGGCGAGCTTTAAAGGATTTAATTAGCACAATAGATCGTACGATTGATGAAATGGGTGGG
AATAAGCCCCCAACAAATGCAAACCCTGGTTCTAGTTAAAGTACAGCTGGGAATAGTACG
GATGAAACTGGCATAGGTTTTGGGCAGCCAAATATGCAGAAAAGTAGGCTAAACTAGATA
GAAGACGATAATGAGGAAAACTATATATAGGACGATAATACCGACGAGACAGATTAGCAG
AACCCAGACAATATAATTAATTGTCCTCCTCTACCTTTTGCTAGAACCAATTATAACAGA
ATACTAAACAACAAAGCACTAAAAAAGGTTTAACTTAAAATCCAAATTTATAAGATGCAA
CTCACTGTCAATGATATCGCCAGTAAAATAAAGTGTTAATTTGATGAGGAAGAAGACATC
ATAGCAGGAACTGGAACAGCCACTGCGGAGACCGTATCTACCTAGGTTTCTAGTATTCAG
CCTACTCCATAGAAAAGATTACGAAAAAATACTGTTTTATGA


>Contig2932.0.g32(protein)
MDSVFKRNRYQQSYGNGYDRGGQSGGGGSYRGGSSGGGGSSQYRRGGYNGGGGGYNGGGG
GGGGFNRNQYGRSRSRFDNQYRGKSQARDDAGGSSSGGGYGSTYQSQQQSSTTRSTFQPP
GFEAYSYNPQSSNNNNSNSSGYGNNQQNGDNNQNNTQQTQQKFQRQGDPDEEVKQFELSV
KKKVQVKRYYGEVFVDLREFFIKGEKYLPTKKGVTLKMDHWRALKDLISTIDRTIDEMGG
NKPPTNANPGSSQSTAGNSTDETGIGFGQPNMQKSRLNQIEDDNEENYIQDDNTDETDQQ
NPDNIINCPPLPFARTNYNRILNNKALKKVQLKIQIYKMQLTVNDIASKIKCQFDEEEDI
IAGTGTATAETVSTQVSSIQPTPQKRLRKNTVL