Identifiers and Description

Gene Model Identifier

Contig22442.0.g67

Standard Name

SUB1a

Aliases

Contig22442_0_g67

Description

Transcriptional Coactivator p15 (PC4)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000461202.0004286606204839e-16Putative RNA polymerase II tra
nscriptional co...
SGDYMR039C0.0000000400154582995175SUB1 SGDID:S000004642, Chr XII
I from 349522-348644, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22442.0.g67(coding)
ATGAGCGAGAGACACTCAGAACATTCCTCAAGAAAGGACAAAAAGAAAGATCACAAAAAG
TCTAAGAAATACTCAAAGAAAGAGAGAACAGAGAGTAGCGATTTAAGCAGCATTAGCAGC
GATGATGACGCACAGTTAAGAGACTAGTTAGAATAATTATCAGAGAGTGAACTTAAAGAC
GAAATTAGAAAGATTGTGTAGGAGAGTAAAAGCTAAAAAAGTAATAAAGGCAAAGAAATT
GAGGAACATAGAAAGAGAGACAAAAAGCTTTAGGAAAAGTTAGAAGCTAAGTATGGAAAA
CTTTCTGGTGATAAAAAGCGCAAAAGATCAGAGAATTCCTTAACTTCTTCTCAGCCAAGC
AGTGACAACGAAGAATAGAAACAAAATAAATCTCATTCATAAAAGTAGCACTCATAATCA
TCCTAAGTTATGTTTAAGCCAACCTATGATAAAGAGGGTAGCGCAATATTTGAGTTAAAC
AATAAAAAGAAGGTAGTTGTTAAGAAATACAAGGGCATGACTTTAGTTGATATAAGAGAG
ACTTATGAAAAAAATGGGGAAACATTGTTTACTTAGAAAGGTGTGTCTCTTACTCTTGAA
ATGTTTGAAAAGTTGAAAGATATGCTGCCTAGTATAGATTAGGAACTTAAAAAGTTTAGA
TGA


>Contig22442.0.g67(protein)
MSERHSEHSSRKDKKKDHKKSKKYSKKERTESSDLSSISSDDDAQLRDQLEQLSESELKD
EIRKIVQESKSQKSNKGKEIEEHRKRDKKLQEKLEAKYGKLSGDKKRKRSENSLTSSQPS
SDNEEQKQNKSHSQKQHSQSSQVMFKPTYDKEGSAIFELNNKKKVVVKKYKGMTLVDIRE
TYEKNGETLFTQKGVSLTLEMFEKLKDMLPSIDQELKKFR