Identifiers and Description

Gene Model Identifier

Contig4890.0.g109

Standard Name

STK98

Aliases

Contig4890_0_g109

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam11167 ) Protein of unknown function (DUF2953)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003103202.0007019863683806e-141Protein kinase domain containi
ng protein
SGDYDR477W1.0003926095686843e-81SNF1 SGDID:S000002885, Chr IV
from 1412373-1414274, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4890.0.g109(coding)
ATGATCCCATTAGCTAAGGTTAACAAGAACAAATTAAAAAAGAATCTTCATAGCAAAATC
AAGATGCTTCAAAAAGGCAGTCTACTTAAAACGCTTAAAATTCAAGACAAATTGGTCATT
ACATTGTTGGGAACATTTGGAAAAGTGAGATTGGGCACGCATATGCTAACTGGGGAAAAA
GTTGCCATTAAGATACTTGAAAAAGATAAAATTAAAGATCAAGCTGATGTAGAAAGAGTG
ACAAGGGAAATACACATATTGAAGATTGTCAGACATCCAAATGTTGTTCAGTTATATGAG
ATAATTGAAACTTCAAGATAGCTATTCCTCATCATGGAGTATGCAAGCGGAGGTGAATTA
TTCGATTTCATTGTGAAGAGGAAACGACTTTAAGAACCCGATGCTTGCAAATTTTTCCAG
CAGATAATCTCAGGAGTTGAGTACATTCACAAGATAAAAATTTGTCATAGAGATTTGAAG
CCAGAGAATCTACTGCTTGATGAAAAGAATAACATCAAAATAGTTGACTTTGGTCTCTCT
AATACCTACAAAAAAGGTGAACTTTTGAAGACTGCTTGTGGATCTCCATGCTACGCAGCT
CCAGAAATGATAGCAGGCAAGAAATATTAAGGACTGATATCTGATGTGTGGAGTTGTGGA
ATTATTCTGTACGCAATGTCATGTGGATATTTGCCTTTCGAAGATCCAAACACTAATAAG
TTATACAAGAAAATCCTTAATTGCGATTATCTATTACCTGGGTTTATTTCTGCACCATGC
AAAGACCTAATCAAGAAAATTCTAAATACTGACCCAAACACTAGAATTTCAATAAGAGAC
TTGAAAAATCATGAGTGGTTCAATTAAATTAAGAAAAAAGACAGTCAAGGAATTATAGTT
GGAAAAGATAAAGTCCCCATTGTTGAAGAAATTTTACCTAAATTACAAGAACAATTTGGG
GAGGATTCTATCACTCAAAATATAATCTACATTTTGAACAACAAACACAACTAAGTTACT
TCAACCTATTATCTTCTAATAAAGAAAATAGACAGAGACCAAGGAAAAAACTTGGTATTT
GATTAATTCGCAATAGAAAAGAGACATCCAAATTAGAATAATAGTGTAGTGAGCAATATT
TCATCTGTCAACTTTGGATCCCCACAAACTAAAATCAGCATGCCTAATAAGTTAATGATG
AATCAAACTACTATTGGTAATTTTCAAAGAGCAGGTGCTCAAAATACCTCAAAATCTTAG
GGAAAGCCTAACAAAAATGCTGAGTAAAACTAGAGTTTAGTTGCAAAGATTTATCTAGAA
TAAATGGATAAGATCTATACCAAGAGAACAGAATCAACAGGATAGGCAAGAGCAACTGAT
AGTTTAGCAAACTATAACTACTAATAATAAGATATGAATGATCGGCCAACAAAGTCAGGG
ACTGTTAACTTAGAAACATTAGCACAATCAATGATTTCTTAAAACACCAAGCATCATTAA
GCAGTTATTAGAGCTACTTAGAGTTAATCCCCAACTAGTAAACTAATGAATTTAAACATA
AATATGCACACAAATGCATCAGCAACAGTAGGCATTCAGAATTAGAACAATACATTCTAC
ATGGCTGATAGATTGAACAAAAAGAATCAAAATCATAATAATCACTTCAACAGACCTGTA
AGCATTGATGAAAATGTGGGGAACATGATTATATCTTCCACAAATGATTCAAGAATTCAT
GAGATATTGCCTAATGTACAGAGATAGACAAATAATAAATCAGTTCATATGAGATCCACG
ATGTATAACAATTCTTACATCAATAAAATCAACAATATGATCAGTAATAACTAAAGACCA
TAAAAGACAGATGAAGGATAGAACACTATAAACATAACGAATCAAAGACAATTAAATGGA
GTTAATAATGGAATAAATGTAACTAATGTGATGCTAAATACAATGTATAAGCCTGTTTAA
ATGTAATAAAACACCATGAACACTCAAGCTATTTCAAAAGCCATTGCTTCTTAGAAAGTG
AGAAAGTTTCGATTGTAAAATAGAAACATAAATCAAACATTTACTTAAGACTTATCCAAA
GATTTAAATCAAACTTAGGCATATGAGCAATTGCAAGAGGACAATTCATCATAAGTTTAG
CCATTTAAACAAGATACTAAGTTATTCACTATTTATAGACCTAAAAAGCAAGCCAAACTC
ACGAATCAATACACCAACAGGACAAATGGAAATTAAAGTTATGATTATTCAAATACTGAA
TAGTCCAGTATTGTTCAAAATGACAAGATTAATAACAGTTTCACTGCTGGCCCTAATTCA
ACAGCTAGTAGGTTCTATAACCCCAATAAACATAACAGATTTCTGTCAAATAACTACAAC
TCAAATATGAAGTAAATTAACGTCTAGCCAGTCTTTTAAAACAATTTTATTCTTCCAATG
AGTTTCAATTCTGCAATAACAACTAAAACATTCTATAACTTAAACAAGACTAATACTAAT
GTAAAGCAATAGTAATAATAGAAACAGGGCAGTCCTAGAGTAAGTGTACTTGATTAATCT
CATCAAAGTACAGCATCTACTTCTCAGGCAGCCTATCACATTCAAAATATCATATAAAAA
TAAGGTAAACTATAATTATATTTCATATTTTATATAGACATTAAATCCAAGGGAACAATG
AATGGAACTATGAATAATTTTTTCACTGCAAATACAGCAAACAATAAGAGGCTGCTGATT
TTGTGA


>Contig4890.0.g109(protein)
MIPLAKVNKNKLKKNLHSKIKMLQKGSLLKTLKIQDKLVITLLGTFGKVRLGTHMLTGEK
VAIKILEKDKIKDQADVERVTREIHILKIVRHPNVVQLYEIIETSRQLFLIMEYASGGEL
FDFIVKRKRLQEPDACKFFQQIISGVEYIHKIKICHRDLKPENLLLDEKNNIKIVDFGLS
NTYKKGELLKTACGSPCYAAPEMIAGKKYQGLISDVWSCGIILYAMSCGYLPFEDPNTNK
LYKKILNCDYLLPGFISAPCKDLIKKILNTDPNTRISIRDLKNHEWFNQIKKKDSQGIIV
GKDKVPIVEEILPKLQEQFGEDSITQNIIYILNNKHNQVTSTYYLLIKKIDRDQGKNLVF
DQFAIEKRHPNQNNSVVSNISSVNFGSPQTKISMPNKLMMNQTTIGNFQRAGAQNTSKSQ
GKPNKNAEQNQSLVAKIYLEQMDKIYTKRTESTGQARATDSLANYNYQQQDMNDRPTKSG
TVNLETLAQSMISQNTKHHQAVIRATQSQSPTSKLMNLNINMHTNASATVGIQNQNNTFY
MADRLNKKNQNHNNHFNRPVSIDENVGNMIISSTNDSRIHEILPNVQRQTNNKSVHMRST
MYNNSYINKINNMISNNQRPQKTDEGQNTINITNQRQLNGVNNGINVTNVMLNTMYKPVQ
MQQNTMNTQAISKAIASQKVRKFRLQNRNINQTFTQDLSKDLNQTQAYEQLQEDNSSQVQ
PFKQDTKLFTIYRPKKQAKLTNQYTNRTNGNQSYDYSNTEQSSIVQNDKINNSFTAGPNS
TASRFYNPNKHNRFLSNNYNSNMKQINVQPVFQNNFILPMSFNSAITTKTFYNLNKTNTN
VKQQQQQKQGSPRVSVLDQSHQSTASTSQAAYHIQNIIQKQGKLQLYFIFYIDIKSKGTM
NGTMNNFFTANTANNKRLLIL