Identifiers and Description

Gene Model Identifier

Contig17156.0.g69

Standard Name

STK95

Aliases

Contig17156_0_g69

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam10707 ) PhoP regulatory network protein YrbL
  • ( pfam06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005230006.000481660141652e-51Protein kinase domain containi
ng protein
SGDYDL101C5.998760051700188e-30DUN1 SGDID:S000002259, Chr IV
from 281848-280307, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17156.0.g69(coding)
ATGAAATTATGGGTGAAAAATTTAAATAAATATGTTATTAGACATTGCTGGCAATCTGAG
TTTGAACTAGTAAAAAAAATTGGAAAAGGCGCTAATGCCTAAGTTTATCATGTTAAGAGT
TAATAAAAAATTAAAGATTCAACTAGTAGTAAGAGCGAGTTAAAGATTTAAGACTACACT
TTGAAAATAATAAAAAAGAGTGATCTGGGTGAATAAAATGATAAAATTCAAATTATTAAA
AATGAAATTCAAACACTAAGACTACTCAGCAACTGTAAATAAATAGTGTAATTATACAAA
GTATATGAGAGTGAAAAAAGTATTTATTTGTTATTGGAATATGTGAATGGTGGAGATTTG
TAAAACTTTATTGACAAATAACTCGATGAGATTATACCTGAAAATTAATTAAGGCCAATC
ATGGTCGAGTTACTTAGAGGTTTGGGCTAACTTCACGAAAAGAATATCATTCACAGAGAT
ATAAAACCTCAAAATATTCTAATTCAGTACTCCAGTAATGGGGATGTTGAAGTAAAAATT
GCAGATTTTGGGCTCGCTTAGAAAATATAAGAACAATAATTATTGATAAAGTAATGCGGT
ACTCCTGGTTTCATAGCTCCAGAAATATTGAAAGGAGGTCTTGGGTATGACACTAAGGCC
GACCTCTTTAGTATGGGCAGTTTATTATTTTAATTATCAACTGGCAAATAATTATTCCCA
GGTAATTTCATCTTTGAAGTTCAAGATCATAATATGGCTTGTAGCATTGGACATACTATT
CCTTATCTGCAGAAATATACTTCAGCAAGCCTTCAAGACTTAATTCTTAAATTGCTATAG
ATAAACCCCGTAGTACGTTATGATTGCAAATAAGCTCTTAAACATAGTTGGTTTTCTTAA
AAGAGAGCTAGCTCGGTTATTGGAAGTATTAAAACAGATTAATAAAAAAAAAACAAATAA
GGAAAAAATAAATCAGAGTATTGA


>Contig17156.0.g69(protein)
MKLWVKNLNKYVIRHCWQSEFELVKKIGKGANAQVYHVKSQQKIKDSTSSKSELKIQDYT
LKIIKKSDLGEQNDKIQIIKNEIQTLRLLSNCKQIVQLYKVYESEKSIYLLLEYVNGGDL
QNFIDKQLDEIIPENQLRPIMVELLRGLGQLHEKNIIHRDIKPQNILIQYSSNGDVEVKI
ADFGLAQKIQEQQLLIKQCGTPGFIAPEILKGGLGYDTKADLFSMGSLLFQLSTGKQLFP
GNFIFEVQDHNMACSIGHTIPYLQKYTSASLQDLILKLLQINPVVRYDCKQALKHSWFSQ
KRASSVIGSIKTDQQKKNKQGKNKSEY