Identifiers and Description

Gene Model Identifier

Contig12436.0.g45

Standard Name

STK92

Aliases

Contig12436_0_g45

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004120709.000069281166703e-132Protein kinase domain containi
ng protein
SGDYMR001C7.000402845995459e-29CDC5 SGDID:S000004603, Chr XII
I from 271136-269019, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12436.0.g45(coding)
ATGGCAAGTGCAGCCGTTCAAGTTCAAAATTTCGTAGGAAAGGAAGTCAATGGATTTGAA
ATTATCAAGCTTATTGGTCAAGGAAAATTCTCATATGTTTTTAAAGCGCAAAGAAAGACA
GATGGTCTATGTGTGGCTCTAAAATTGATAAAGAGACAATTGCTTGAAGGAAGTTTAGCT
TCATTAGACCATCAAAACATTGTCAAGTATCTCAATTGGTTTATCGATAACAAGCTGAAT
GAACTATTTATCGCTGTCGAATGGGCAGAGAAGGGGGATTTGAAATTGATCATAAAGAAA
GCAATTGAGGAAGACGTGAGCTTTCCAGAAAAGAAAATATGGGAATACATTCATTAAATT
GCAGGAGCACTTGGACATATGCATGAGAAACGTATTATGCATAGAGACTTGAAACCGGCA
AATATCTTTATCGATTAACAGGGTAATTTAAAAGTTGGAGATTTGGGACTGAGTAGGTAA
TTGGGTTCTCAAACTTTTGAAGCCTTCTCCAGAGTTGGGACACCTCTATATATGAGTCCA
GAAGTCTTACAAGGCAAAGGGTACGACTGGAAGAGTGATGTATGGAGTTTAGGATGTATT
GCTTATGAGATATGCATGCTAAGGAGTCCATTTAGACAGGATGACAAAGAAAACTTATCG
CTATATGATTTGTTCCAGAGAATCACAAAGGGACAGTTTCCTCCTATAAGCGAGAAATAT
AGTCCGGAGTTAAGATAAGTAGTCATGGCTATGCTTAAACAGGATCCTGATCAGAGATTT
GACATTGCTTAAGTTTGTGAATTATGTGAAACTTACAAAAAGATGATAGCTAGTAAACCA
CAAATAGATACTTATCTCATTATGGATGATATTATTGAAAAGCTGAGTCTATTAGACTAT
GAGAACTCATTTTGCAAAGGCTGGAAACAAAAAAGGGTTTCTAGAATATATTTTGCTCAT
CCTAGTACAGGAGAAGATCCAACTTAAAGAGCGAATTATGTTTATGACATGACATTTTGG
CTTATGTCTCTTAATAAAGAAAAGAGCAAGAAACTTGGACCGTTTGTACCTTTTAAGGAT
TTCAAAGGAAATTTGAATGATGCCATGGCTAAACTTATTACTGACTTGAAAAAGTTTGGA
TATTCAGGAGGAAAGACACTTAGATAAGAGCAAATTAAGCCTGGATATGGTAATGAAGTA
TGTCACATCATTGACGAGCTTTTAAATCTTGAGCTATATCGTCGAGAGTTCTAATTCAAT
TAGCCTATTATTCCTCCAGATGACGAAGAGCCTCAAGAAGATGATGAATAAGATGATGAT
TAAAACGATTCAGTTATAATGATAAACGGAGGTTAAATTGAAGCAAGGGAGATAAGGTAT
TCCTCTGAACCTTATAACATAGGAAGTTCTTCAAATCAGAAATAAAGAAACAAGTAGCAA
TTTCTAAATGGAGAGGAGACCAAAATCAACTTCTATGATCCTTAGGCTTATTTAAGGAAC
GGTGATAAGTATTACTAGATAGAAAAGGAAGAGGATGAGTAAATTTTGGAGGGTAAAATT
GACCCTCAAGAGTGGAGAAGAGAGATGGATAGAGTCTATGGTGATCTTGATGCTATAGAG
AAAGACATTGAATTAAGTAAATAAAGAGGCTAATTTGCAGGTGGCAATTATGATGATGAT
GTCGAAGAGTGCAGAAGACACATTGAGTTGATAATCGATTTATGCAGAGATATCAAAGAC
ACCTGTCATTAAGATGTTAGAAATGTATTTGCTAGGTCTGCCGAAAAGCTGGAAGAAGAT
TTGTCGTACATAAGAAAGAACGAAATCAGAATCAACCAAAATAATGCTGCCTAAATTACT
AAGTTGAATTCCATAACTTAAACTAAGAAAAACCTTGCATAAGAACTAAGACAACTTATT
GATATAGTGAAGAAGTTAGACTTTGAAAATAAAGACCTACAAAATAAAATCAACTCCTTG
AATCATTAATACGATGAGCTTGTAGCCGATATTGGGGGTTAAAGACAAATCAAGAAATTA
AAGTCAACAATAGTTGAACTCAAGAAGCAAATAAAGGAAGTTTCATTAAATGAGGGAATA
ATTCAGAACACTTTATTCCATTGTGACCATATGCACAAAGGCAAACATCATCTCTTTGAT
GAACTAGATAAAGGAGGCATTTTAGAGGACAGTCATAATTTAGATGATGAATTTTATAAG
AGCTTAAAATTGTAATAGAGTTCAAAAAAACTTAAGATAGATATTAAGGCATGA


>Contig12436.0.g45(protein)
MASAAVQVQNFVGKEVNGFEIIKLIGQGKFSYVFKAQRKTDGLCVALKLIKRQLLEGSLA
SLDHQNIVKYLNWFIDNKLNELFIAVEWAEKGDLKLIIKKAIEEDVSFPEKKIWEYIHQI
AGALGHMHEKRIMHRDLKPANIFIDQQGNLKVGDLGLSRQLGSQTFEAFSRVGTPLYMSP
EVLQGKGYDWKSDVWSLGCIAYEICMLRSPFRQDDKENLSLYDLFQRITKGQFPPISEKY
SPELRQVVMAMLKQDPDQRFDIAQVCELCETYKKMIASKPQIDTYLIMDDIIEKLSLLDY
ENSFCKGWKQKRVSRIYFAHPSTGEDPTQRANYVYDMTFWLMSLNKEKSKKLGPFVPFKD
FKGNLNDAMAKLITDLKKFGYSGGKTLRQEQIKPGYGNEVCHIIDELLNLELYRREFQFN
QPIIPPDDEEPQEDDEQDDDQNDSVIMINGGQIEAREIRYSSEPYNIGSSSNQKQRNKQQ
FLNGEETKINFYDPQAYLRNGDKYYQIEKEEDEQILEGKIDPQEWRREMDRVYGDLDAIE
KDIELSKQRGQFAGGNYDDDVEECRRHIELIIDLCRDIKDTCHQDVRNVFARSAEKLEED
LSYIRKNEIRINQNNAAQITKLNSITQTKKNLAQELRQLIDIVKKLDFENKDLQNKINSL
NHQYDELVADIGGQRQIKKLKSTIVELKKQIKEVSLNEGIIQNTLFHCDHMHKGKHHLFD
ELDKGGILEDSHNLDDEFYKSLKLQQSSKKLKIDIKA