Identifiers and Description

Gene Model Identifier

Contig22602.0.g47

Standard Name

STK87

Aliases

Contig22602_0_g47

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005791803.9980924833248586e-133hypothetical protein
SGDYFR014C8.998068369452149e-53CMK1 SGDID:S000001910, Chr VI
from 173877-172537, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22602.0.g47(coding)
ATGGGTTGTTAATAAACTTGTCAATCAAAGCCACTTCTAGTTCTTGAAGAAACCTACACT
AACTCTGAAGAGTACACTTATTCATCCAATAGTATGCGAGAATCTAGCAGGTTAATGTAA
ATGAAAAAGTAAAATTATCATAAGAATCATAATAATCTAAAAAGTGGGAATTCTACTTTG
CTTGAGTTTATAAAACAAAAGGAGAGTATACATAAAAAAGATGCTTTAATAATATCCAAT
AAAAAGAAATCAAAAGATAATGTTGTTTATGATGAATATGACTAACTTGAGAAACCTAAA
TTCTACAATAATTTTTGCTGTACTAGAAATCAACCCACAAGCTAATCAGACAAATTATCA
TTTAGAGACTAAACCCACAAAGAGAATAACCTGAATAAAGAAAAACCAGATCCATAAAAT
TTATAAAAACTTATAAAAGGAAAACAAAGTAAGTAAAAAGCAAATACAAGTCCAAGCATC
AAAGTAGAAGATGTCCATTAGAATTAAAATCATCCAAGAGCTAAGCTTTTATTTGACAAG
AATAATATACAGTTGCTCAATTAAAATAACTTATAAGCGAACCCACTAGATTTCGAGGAT
CAAAGCAAATTATTTTAAAAAATCAATAAAAACTCAGACCGTTCGAGTCTGATGGCTAAT
AAAAGAGCAAGTTTTAACATGAGACTTAACCGAGAGGGGAATAATGGAAATCCATACAAG
CCGCTTATGCATTAAAAATTAAGCATGCCACGCAAGACTACAACACCTTTTATGTTTTAA
TAGTATGAGCAATTTAATGTCCTTCTTAATAAGTTGAACTATGACGAGGACTTGTAAAAT
AGGAATTTCAAGCCTCTAGATTTCAAATATAATTAAAATGATAGCAAAAAAAGATAAAGT
AGTAGTAGCAGTAGTGGTAACTAAGGAAGATCTGATAAAAATTCAGATAGTATCAAAAGT
CAGTTTGAAAATGACTAAAGCAGCAGAGAAGACTAGCAAAGCTGTATAAAAATAAATAGC
TAAGGCAGCTCTGAGAGTAGCTCTCCTAAAAACAACCATATTGACATTAATTTCAAGAAG
TCTACTTTTGCTAATTAATAGAGATAGAAAAGCACAAAAAGACCAGTTTAAGCACATTTT
TAAAAAAGCTTAGAACAAGATTAAGAACCAATGCACTATAATCATCAAGAAGAGAGTAAG
AAGAAAAAAGATAGTGCAGAAAGAATACTAGAGGCAAACAAAAAAAGCATAAGCTTGATT
TTAAATGAATTGCAGAAATAAATTAACAGCTCATCAAATAGGAATGGGCCCACAGTGGAA
ATAATACAACAGGAAGTTACAAAAATAAAAAAATACTATTATGACTCTCCAAAGTCTAAC
TTGAACCAATCCCAAGATAGTCCGAGTCTAAGAAACATAGACAAGCCTGTCATTGTTATA
GGTAATATAAATAGTGAACTTCGATAGTCAATAGCTGAGTAAACCTTCAAGAGAGATCAA
ATGAAATCTGATATAAATGTTAGCAATCTTAATGGGCCCTCTTTGAATCTTGAAAGAGGT
CAGAGTAAAAGAAGAAAGAAAGGGAAGGGCAAGAAAAAAGAAAAAGTGATTGAGACAACT
AAAACAACTTAACTACTATTTCACACTGGGATGATGGGTTAGTCAAACAACAAAAATAGT
AATACAATAGACATTAATTACCAAGATGTGATGCCTGACGCCATTCTTGATAACACCATA
GAAGAGAATAAGAATGACTAATATGATGACTCCTCCCCTTTGCAATAGTAAAGAAGTAAT
AACCGTAAGAAATCTCCTAGAAAACAAAACAAAAAAAGCAAGGAATAAAAGAGAGGCAAG
ACTCACTTGAATTTGCCAGCGCAGTTGAATCTAAAAAAAGAGAAATCTATGAATGTGCAA
AGAAACATAAAAAGCAATGTACTTGAAGATACTGATCCTCATTTCAAGGAGTTTTAGAAT
AAATGGCAGTAGAGATAGTATGACAATACTTACAATCGGGAGTTTCAATCTGTGATATTG
AATAAGCACAAATCCGTCTCAGATGCTTCAAATTAAAACAGCCCAAAGTCAAAATTAGCG
AACAATAATTCGAAAACATAAAAGAACCTGAACTTAACCTAACTAAAATCTTTCAATTTT
AATCATATGAGAAGGAATTCATCTATTTCATCGAGGAGAATGACTCTTTCGAAGTAGTTG
TTTATCAATGAAGGAAGAGGGAAAATTGAATAGAAATATGATTTCTTGGAAACTATTGGT
CAAGGAGGCTTCGGATTAGTCAGGAAAGTGAGACATAAGATTACTGGGGAAATTAGAGCT
ATGAAAATTATTCAAGTTGACTAGTATGATTAGAGTACTTTAAAGAATTTATCAAATGAA
GTAGAAATTCTCAAACAATTAGATCATCCTAACATTGTAAAAATCTATGAATTTTATCAG
GATAAGAAGAACCTGTATTTGATTCAAGAATTCATTGCAGGAGGTGACTTGTTTGAAAAA
CTTAAAAACTCAAAAGGTGGATTCGAAGAGAACACAGCTGCCTTAATTATGAAGCAAGTG
CTTTCTGCGGTATTCTACTGCCATAAAAATGGAGTAGTGCATAGAGATCTGAAGCCAGAA
AATATTCTGCTTGAGGATGGCAATAACTTCAACAACATTAAAGTCATTGATTTTGGAACG
TCTAGAAACTTCGAGGGATCTAAAAAAATGAATCAGAAGTTTGGAACAGCTTATTATATT
GCACCCGAGGTGTTAAAGAAGAATTATGATGAAAAATGTGATATTTGGAGTTGTGGAGTA
ATTTTACATATTATGCTTTGTGGCTATCCTCCTTTCAGAGGCAAAAACGAAAAAGAAATC
TTGGAAAAGGTAGAGATTGGTTACTTCTCTTTGAGTGGTCCTGAATGGAAAGCAGTATCT
AGAGAAGCAAAACTTCTTCTGAAATAAATGCTCTCTTATGTTCCAAAAGATCGTATAACA
GCGGAATAAAGTCTAAACTCAACTTGGATCTAGATTCAAAGCAAAGTGGAGATTGTTACC
TTAAGAGAAGCATAGAACGCTTTGAAAGCATTGAGAAATTTTAACATTGACATTAAACTG
CAGCAAGCAGCCTGTCTATATATAGCTAGTTAGCTGCTAACCAGATAAGAATTGATCAAG
TTTAAGGACATTTTCAATTGTTTCGATATCAACGGAGACGGCATTATCACACTTGATGAA
TTGAAGGAACTGCTAACTTAGCACTTAAATCTAAGTAAAGATAGGTCCAATAAAGAGGCT
TACCGAATATTGCAAAATTTGGATATTAACTAGAATGGTGCAGTTGACTTCACTGAGTTT
GTAATTGCTATAGTATCTACTAAGGATATATTAACTGATGATAAGCTGCTAAATGCTTTC
AATATGCTTGACATGGATGGCAATGGCAGAATAACGAAAGAAGACTTGTAACAGGTGTTT
AAAGGATCTCCTGAAATAAATCAAGATTAAATGCTTGATGAAATGATTCAAGAAGCTGAT
GAGAAAGGTGAAGGAGAGATAGCATTCCAGGAATTCAAGAAATTAATGTTACTAATGTAG
AAACAAGGCCCAACCTAAGAAAGTAACAATTTAGTGGGTACCTATCAATAAATGCAAAGT
GAATCAATTATATTATGA


>Contig22602.0.g47(protein)
MGCQQTCQSKPLLVLEETYTNSEEYTYSSNSMRESSRLMQMKKQNYHKNHNNLKSGNSTL
LEFIKQKESIHKKDALIISNKKKSKDNVVYDEYDQLEKPKFYNNFCCTRNQPTSQSDKLS
FRDQTHKENNLNKEKPDPQNLQKLIKGKQSKQKANTSPSIKVEDVHQNQNHPRAKLLFDK
NNIQLLNQNNLQANPLDFEDQSKLFQKINKNSDRSSLMANKRASFNMRLNREGNNGNPYK
PLMHQKLSMPRKTTTPFMFQQYEQFNVLLNKLNYDEDLQNRNFKPLDFKYNQNDSKKRQS
SSSSSGNQGRSDKNSDSIKSQFENDQSSREDQQSCIKINSQGSSESSSPKNNHIDINFKK
STFANQQRQKSTKRPVQAHFQKSLEQDQEPMHYNHQEESKKKKDSAERILEANKKSISLI
LNELQKQINSSSNRNGPTVEIIQQEVTKIKKYYYDSPKSNLNQSQDSPSLRNIDKPVIVI
GNINSELRQSIAEQTFKRDQMKSDINVSNLNGPSLNLERGQSKRRKKGKGKKKEKVIETT
KTTQLLFHTGMMGQSNNKNSNTIDINYQDVMPDAILDNTIEENKNDQYDDSSPLQQQRSN
NRKKSPRKQNKKSKEQKRGKTHLNLPAQLNLKKEKSMNVQRNIKSNVLEDTDPHFKEFQN
KWQQRQYDNTYNREFQSVILNKHKSVSDASNQNSPKSKLANNNSKTQKNLNLTQLKSFNF
NHMRRNSSISSRRMTLSKQLFINEGRGKIEQKYDFLETIGQGGFGLVRKVRHKITGEIRA
MKIIQVDQYDQSTLKNLSNEVEILKQLDHPNIVKIYEFYQDKKNLYLIQEFIAGGDLFEK
LKNSKGGFEENTAALIMKQVLSAVFYCHKNGVVHRDLKPENILLEDGNNFNNIKVIDFGT
SRNFEGSKKMNQKFGTAYYIAPEVLKKNYDEKCDIWSCGVILHIMLCGYPPFRGKNEKEI
LEKVEIGYFSLSGPEWKAVSREAKLLLKQMLSYVPKDRITAEQSLNSTWIQIQSKVEIVT
LREAQNALKALRNFNIDIKLQQAACLYIASQLLTRQELIKFKDIFNCFDINGDGIITLDE
LKELLTQHLNLSKDRSNKEAYRILQNLDINQNGAVDFTEFVIAIVSTKDILTDDKLLNAF
NMLDMDGNGRITKEDLQQVFKGSPEINQDQMLDEMIQEADEKGEGEIAFQEFKKLMLLMQ
KQGPTQESNNLVGTYQQMQSESIIL