Identifiers and Description

Gene Model Identifier

Contig15625.0.0.g55

Standard Name

STK86

Aliases

Contig15625_0_0_g55

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004677405.000673719166372e-136Protein kinase domain containi
ng protein
SGDYAR018C4.998444157800704e-72KIN3 SGDID:S000000071, Chr I f
rom 171703-170396, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15625.0.0.g55(coding)
ATGGATAATTACGAGAAAATTTGTGAAATTGGCAAAGGCAGTTTTGGCTCAGTCTCAAAA
ATAAAGAGAAAAGCTGATGGAAAGACCCTAGTTTGGAAGGAGCTAAATTACGGGAAAATG
TCTGATAAAGAGAAACAGCAACTAGTGTCTGAGGTCAATATTCTCAGAGAACTCAAACAC
CCCAATATTGTTCGCTACTACGATAGAATCATTGATAAAGAATCTGCTAAGATTTTCATC
GTCATGGAGTATTGTGAAGGAGGAGACATGGCAGCTCTGATTAAAAAACACAAGCGTGAG
AAATAATATGTTTCTGAAGAGAAAATATGGAAGGTACTTGCGCAAATGATTTCTGGGCTT
TATGCATGTCATAGGAAAAAAGAAGGAAACAGAATCTTGCATAGAGATCTCAAGCCAGGA
AATGTTTTCTTTGATGCCACAGGAAATGTAAGAATTGGAGACTTTGGACTCAGTAGAATG
ATGGGAGAGGAGTCAGTATTCGCTAACACTCATGTTGGCACGCCCTATTACATGTCCCCT
GAACAAATTTCAGATTAAAAGTACAATGAGAAGAGTGATATCTGGTCAGCTGGCTGTGTC
ATCTACGAGTTGACAGCACTTAGAGCCCCCTTTGAAGCGACAAATTAAATTCAGCTTGCT
ATGAAAATTAAGTCAGGAAAGATTGATCCCTTACCTTCGTAGTACTCTGATGAACTATTT
AAAGTGATCAAATTAATGATGAGCCTTGAGAAAGAACAGAGACCTAATGTTGATGAGCTC
ATGCCACATCCTAAAATAAGCTGTTTCCTCAAGGAATAGTCAATGAAAGATATGATATCA
GCGAGCAAGCATAAAGAAGAAGAATTATTAAAGAAGGACAAAATGATAAAGAAAAAGGAA
TAAGATCTTGCTTAACAACTCAAAGAGCTTGAAGAGAAGGACAAAATGCTCAAAGAGTGG
GAAGAGAAATTACTATAAAGACAATCTGCGCTGCTTAAATAGCAGTAATAGGTCAGCAAT
AGCAAAATCAATGAAAGCATAAATATGGTAGTTGAAACACCAGGATTAACAGTGGATAAC
AGAAATAACCGATTCTCAGAAAAGATGTAAATAGAGGAGTCTCCTAAAATGAGTACTCAA
GTATCTAGACGTCCAGAAAGCTTGCGAAGAATGAGTGGAAATTCATAATCAAGAGATGCT
CTTCCTTAGAAAGAAATCAGTAAATACGGGGGTTTGGACAGCTACAAAAACAACGCTGAT
ATTTATATGAGCAATGACAATTTCCAGAAGGATCGCATCATTGAAAGAAACTATTCCAGC
TCAGGTCGTGAGCAATAAATTCTACAAGGAACCTAAAAGTAAATCCCTACTAGTCAGCAG
ACTAGCAATCATGGTGCCCCTTTATCTTACAGAAAAGCCCAGACTACCAAAGATTACTTG
CCCCCAACAAGAGAGAAAACCTACCTGAAGCCACCCATCCTCAGAAATCAAGAACAGTAG
TAACCTTAATCTAATCAGTTAATTAGACAATCTCAAGAGAGCAATTTCAGAATGGGTGGA
GGAGCTGATACCCCCACTAATCATCATATGATGAGACCTGCAACATCCTAATCTTCCACT
AGTCTAAGAGGCGGCTAATAGCAATACTCAAGCGCTCTGAGTCAGTCAAGAGAGAACAAA
TCAGGACTATCAAACATTGGTGTTAGCGGAACAACAGGCAGACATTCAAGGCAGTCAAGT
CGGGAGAGAGTCAATAATTTCTATGGTAATGGAGCTGGAACAGGTGGATACACCAATGAA
AACAGCTTCTCTAATAATAACGTTAATGTGTCTGGCAGCTATGACTAAAACAATTCTGGC
TACATGCAGTAATACGATAGAGGGACAGTTGGAAATTAACTTCTGCTACTAATGGCGGTG
GGTACTCTGACAGAGAATAGCAGCAGCAGTAGTACATGCCAGTGA


>Contig15625.0.0.g55(protein)
MDNYEKICEIGKGSFGSVSKIKRKADGKTLVWKELNYGKMSDKEKQQLVSEVNILRELKH
PNIVRYYDRIIDKESAKIFIVMEYCEGGDMAALIKKHKREKQYVSEEKIWKVLAQMISGL
YACHRKKEGNRILHRDLKPGNVFFDATGNVRIGDFGLSRMMGEESVFANTHVGTPYYMSP
EQISDQKYNEKSDIWSAGCVIYELTALRAPFEATNQIQLAMKIKSGKIDPLPSQYSDELF
KVIKLMMSLEKEQRPNVDELMPHPKISCFLKEQSMKDMISASKHKEEELLKKDKMIKKKE
QDLAQQLKELEEKDKMLKEWEEKLLQRQSALLKQQQQVSNSKINESINMVVETPGLTVDN
RNNRFSEKMQIEESPKMSTQVSRRPESLRRMSGNSQSRDALPQKEISKYGGLDSYKNNAD
IYMSNDNFQKDRIIERNYSSSGREQQILQGTQKQIPTSQQTSNHGAPLSYRKAQTTKDYL
PPTREKTYLKPPILRNQEQQQPQSNQLIRQSQESNFRMGGGADTPTNHHMMRPATSQSST
SLRGGQQQYSSALSQSRENKSGLSNIGVSGTTGRHSRQSSRERVNNFYGNGAGTGGYTNE
NSFSNNNVNVSGSYDQNNSGYMQQYDRGTVGNQLLLLMAVGTLTENSSSSSTCQ