Identifiers and Description

Gene Model Identifier

Contig21946.0.g45

Standard Name

STK85

Aliases

Contig21946_0_g45

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam10035 ) Uncharacterized protein conserved in bacteria (DUF2179)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004210707.002037867398653e-67Protein kinase domain containi
ng protein
SGDYDR477W8.999599844922746e-55SNF1 SGDID:S000002885, Chr IV
from 1412373-1414274, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21946.0.g45(coding)
ATGCTGGAGTAGGAAATGGTAATCTTTCTATATGTTTTCAATGATTTAGGTATGGGCCAA
TCATCACGAGGACTAAAGATTAAAAAAGACGATCTCAAGCTAATTTAGCAATACTGCGAG
TAAAATGATCTTGGAATTGTTGATATCCCTGTTTCAAATAATATGATTAGCAATCATCAA
TTCCCTTCACATCATAGAACAAAAAGTGAAGGTACAACTCCAATGGGCTCATCATTTGCT
AAACAGCAATTTCAAGTTAAGTAACAACAGTAGCAATAGCAAATTTAAATGATCTAGCAA
CCTTAATACTAATAATAAAAAAGGCAATTCAATCCCGTATTGGATTATCAAAAATACTTG
GAAGATGAAAGAGTTGTCCAGTATTAAAAGTCTAAGAGCTCTATGGGCTACTATTCTCAA
GGGAATACTCCAAATAATAACACAGGTAGAATTATTCCATAATCCAAGACTCCAGAAATT
TACAATTATTAAACTGCTAATTATAAAACTAGAAAGATTCAATCGTAGATGCCAACACCC
AATGCTAATAAGTAAATTATGAATTAGAATTTTCTGACAAATAATCCAATCATTTAAAAT
ATTATGGGCATGCAAAGCAGAGCTGTTGTAACAACGAGTTAGGGTCAAAGAATGACTTCA
CGTAAGAAACCTCAATCGATTAGTGGAACTCAAAAATATGGAGTCTCGTAAAGTATCAAT
CCAACTTTAAATTACAATGCTTCTAATCCTAGTACCATCTAAAGTATGTACATGAGTAAA
AACCCTTCAACTAACTCGTACAAACTTAAACCATAAAACTCCCTATACAAAAACGATCAG
TTTTCACTAGAAGCTCATTCACAAGATTAGTTAAATGAATCCTCCGTTTATCTCTATGAC
GATCCACTGTTAAAAAGCAGTCATTAAATAAACTTACAGAACAACAAAAATAAAGGATCA
ATTTTACAGTATGGAGGATAATTGTAGGATGAGAGTTATTATGATGCAACTTTATACGAT
TAATTCATGCAAGGTCCACATAATATCTCATAATATTCTTCATCAAAGCCTGAGGAATAG
AATTCTTACATTTAATTCAACCATCATAGGTCAAGTCCATCCTAAAAGAATTATACCAGG
ACTCATATTTAACATAACACTCAAAATGCAAGCCAAGTTCCTTAAAAAGGTAGAAGAACT
ACTAATTAAACTATGTAAAATTCTCTGAATATTAGCAGTTAAAAGTAAAACTAGCAGTAA
TTTGATAGAAGAATGATCATGGGTAGAACTCCATCTCCCAATTTCCTAAAGAAAATTTCT
GGAATGATGCATTATCCTCATGAAAGCTTAATTGTGAAGTAGCATATGTACTAAAACAAT
CACAATAATACTACCAAGAATCTTCTTGCAAGTGGCCACTCTTCCAGAAGATCAAACAGT
AAACAATAATTTTCAACTAATTAAGCAGTAACTAACAACACAACAAGGTTGATAGGTACA
TAATAGATTGCGATTTAAATGAATAGGTCATAGAAGCAAAAATTTGCTAGGTAATAGTAT
GGAACAGCTCTATAACAAAACAGGTATAAGAGTGGATCTATAACTACAAGTGCGAATACA
GCTTAAAATTCTCCAAAAAATCGAGGTATAACTCCAAAAAGAGGAAACTCTAAGTAAAAG
ACTATTCAATAAGTCAACTCAACCACCAATCAAAACTAATTTTATTAAATGCCGATGGAT
TTCGATCAAACAAATGACCAAGCTAAGAAATAAGCTTTTTTAGGCTAGGTAGCTATAAGT
CATCAAAATAAGTTAAGAAAAGTAAATAAAGACGAAGAAATGAAAGCGTTAGCAATGATT
TCTAGTATTGGAGATTAAATTCAAAGCAAATAGCAACTTTCTCAATAGCATAACTCTCAA
TCTATTATTTAGGCTTAACAATTCTATTAACCATCGAAAATGATTGGGGAGATCATGGAG
GAAGAGCCTTAGCCTCTATCAAGCCACGAATTTCTTAATATGGAAGAAATAAGGTCCATT
TAAAAAGAGGCTATGAACAGTCAAAAAGTGAGTAGAATAAAGAAACAAAATACTTAAAGT
TAAAAATCTGAGTTCTCTCCCGGTGCACGGTACTATGATGGTGGCACTGGTTCAAACAAC
ATAAACTAAATACCTAACACTTTAATGATGAAACTTGAATTAAATTAATCCTCAGACAGA
CAACAACTAGATAACTTAGTATCTAGAATAACTTCAAAACTTAAGATAATCCTAGCAACT
TTAAATGTCTTAATCTACTATAAAGAGTCCTTCACAATTATAACAGAAAGCAGTTAAGCC
TAGTCTTAAACAAGCAAGCATGATACTTAAAAGAGAAAGCTTTCAATGAACTCCAATTAA
TATGCATAAATGCAAAATTAGAACATCCAGAATTAAATATAATACGTTTAAGAACCTAAC
TTTAAATCAATAGAAGCTGTAAAAGTATAAAGCTAAAAGCAACCTTCAATTTAGCATCAA
TCTTCCATACCCTCTTAAAACTAGTCTTAATACACAAATTCTCAGTACAACTCTAACGTG
AATGTAAATTATGGAGCTACAGATCAATCTCTAAATAGAAAAAAGACTCAGTCAGTCGAG
CCCCCTAAAATCACCCCTCCAAATGTTGATATGTTCAAAAATCAAATGAATGAGGTTGAG
GAGAAATTGAAAGAACATACTAATTTCAATAAAAATAAATAGTCAATCAATTTTACTGAG
AAAACTCCATTTGAAAAGGAACTTGAAATGAAAGCGCAAGAAATGAAGAATGTTAACAAT
TTGAAAAATAGTCAATAAATGCTAATTTAATAAAATAAAAACTCAGTTCAATCAATTAGG
AAGGACAGTGCTGATAGAGTGTCAGGCATGACTTAAGAATAAATTAAATTACAAAAATAC
AAAGAAGACTCTATATCAATCTTGAAATAGCTTTAAGAAAGCGGAAATATCACTGAGAGC
TTGATTGAAGCTAAATAAAACACAGCAAAGAACAATATCATAGAATTTAAGAAATAAAGC
ACTTAAAAAGTAACCTAGGCAAAGGTGTACTAATAAGTACCTGATGAGATAGTAACTCCA
AGCTCACATAATTAATCAAATTTCACGAAAAAGAAGGCTTCTGTGCTCTCAAGTGATATC
TCCAAATTACAAAATAATTTCATTTCAGAAGAAAAATAAGAGGCAATGATCGAAGAATTT
AAGAATAAAAATTCATTCATAGAAAATGATAATCGATTTTATAGGGAAGAGGAGGAAGAA
GATAAAGATGTTATAATGATTACCTAAGAAGATGAAAGATAAATAAAGGATATAGTCTCA
GACATAGATTATAAAGCATTCTATGGAAAAGTAATGAAAAAGACTAAAAATGCTGAGACA
GATGATGATTTCAAACATTTGAGTCCAAGAAGCAGAGAAATTGCAACTGTTATGAAAGTA
ATTAGCAAATCGTTTAAAGATGCTGATGAGCCTCCTATCACTACGACAGATTTTTATAGA
ATCGGAAAGATGTTAGGTAGAGGAGCATTTGGAAAAGTAAATCTTGCTATGCATAAATTA
GTCAGAAAATTAGTCGCAATAAAATCTCTGAATAAAGAATGTCTCACAGATGAAATTTAA
AAGTAAAAACTTATGAAAGAAGTTGCTCTTCTACTAAAGCTGAGACACAATCATGTGGTA
AAGATTTATGAAACTATTGAAACTGAAAAGCATATAATTATTGTCATGGAACTTTGTGCA
GGAGGAGACTTACTTAATTATGTTAGAAAGCGAAGAAAGCTCAAGGAGCCATATGCCAAA
TTTATTTTCAAGCAAATTATAGACGGACTGTGTTATATTCACTCAAAGTACATAGCTCAT
AGAGATATTAAACTCGATAACATCTTGCTTGATGGAAAGGGAAATGTCAAGATAGCAGAC
TTCGGTATTTCAAAGAAAGGCACTAAAGGGCAAAAAATGACTGAATAGTGTGGTACTCCT
GCTTATATAGCCCCAGAAATTCTCAAAGATAAGGGATATTCTTTCAATATAGATATATGG
AGTGCTGGAGTTGTACTCTTTGCCATGCTTTATGGAACTGTCCCATTCAAAGCCAATAAT
ATGGAAGAATTGCATAAACTGATATTAAAAGGTAAATATACCTTAAAAGACGATATCTCC
ATTGAAGCCAGAAACTTACTAAGAGGTCTCTTGGAAGTTAATCCTGAAAAGAGACTTACT
ATCCAATAAATTTACAGACATAAATGGCTTTCAGATGTTGATCCAAATTTAGAACTCTTC
AACGACCAAGAAAAGGGCATGATTAAGAAAGAGTACACTTATAACGATCCTCGTAGATAT
AATAGAAATGAAAACGAAGAGCCAGTAGATTGCTTTACTGAACATCACTTAGAATCTGTT
TATAACTCCCTGAAAAATGCAACATCAAAGTCCATTATTCTAGCTCCATTCAATTCAACT
TAGAGTTAAATTGACCCCATGGATCAAGCAGAAATTCAAAAGCTCCTCTGCGAGAAAATG
ATGATATTAAACTTAGCTAGACGCTGTAGAGAAATCGATAGACAATATGAGTTCAATAAT
AATGGGGATCTAGACAATGGAGTCTATCACAAATATGTGTACAATTCAGAAGATGGAGAT
AATGATAGTGATAACCCAGAAAACCCAGACAAACTAGATGGAAATTCTGACTTATTAAGC
GTTCCAATGCTTATTAGTGAAAGAAATGAAAAGCGCAAGGGTGGTCGAGCAAGCGTTGAA
AATTCTTTCGAAAATAACAGCAGTATTCAATAAATGCAAGATAGACAAGCTCTGGCTAAG
AAAATTAAAGAAAACTCGAACATTCAAAAAGATTTTAGAAATAAACGTGGGTCAGTTATT
GGCAGTGATTTGGATAATATCGACAAGGATCTTGTACAAACCTTTGAAACTTTCTAATCA
AAGTATTCAAGTAAAAATGACGAGGAAAAGGTAAAGCAAATGGTTGAATTTGGATATCCT
CATGATTATGTCCTGAAATCTTTGGAAGAAAGTGATCCTAATTATTGCACAGCTGGTTAC
TATCTTCTATGTATGGATCAAAACTATTGCTGA


>Contig21946.0.g45(protein)
MLEQEMVIFLYVFNDLGMGQSSRGLKIKKDDLKLIQQYCEQNDLGIVDIPVSNNMISNHQ
FPSHHRTKSEGTTPMGSSFAKQQFQVKQQQQQQQIQMIQQPQYQQQKRQFNPVLDYQKYL
EDERVVQYQKSKSSMGYYSQGNTPNNNTGRIIPQSKTPEIYNYQTANYKTRKIQSQMPTP
NANKQIMNQNFLTNNPIIQNIMGMQSRAVVTTSQGQRMTSRKKPQSISGTQKYGVSQSIN
PTLNYNASNPSTIQSMYMSKNPSTNSYKLKPQNSLYKNDQFSLEAHSQDQLNESSVYLYD
DPLLKSSHQINLQNNKNKGSILQYGGQLQDESYYDATLYDQFMQGPHNISQYSSSKPEEQ
NSYIQFNHHRSSPSQKNYTRTHIQHNTQNASQVPQKGRRTTNQTMQNSLNISSQKQNQQQ
FDRRMIMGRTPSPNFLKKISGMMHYPHESLIVKQHMYQNNHNNTTKNLLASGHSSRRSNS
KQQFSTNQAVTNNTTRLIGTQQIAIQMNRSQKQKFARQQYGTALQQNRYKSGSITTSANT
AQNSPKNRGITPKRGNSKQKTIQQVNSTTNQNQFYQMPMDFDQTNDQAKKQAFLGQVAIS
HQNKLRKVNKDEEMKALAMISSIGDQIQSKQQLSQQHNSQSIIQAQQFYQPSKMIGEIME
EEPQPLSSHEFLNMEEIRSIQKEAMNSQKVSRIKKQNTQSQKSEFSPGARYYDGGTGSNN
INQIPNTLMMKLELNQSSDRQQLDNLVSRITSKLKIILATLNVLIYYKESFTIITESSQA
QSQTSKHDTQKRKLSMNSNQYAQMQNQNIQNQIQYVQEPNFKSIEAVKVQSQKQPSIQHQ
SSIPSQNQSQYTNSQYNSNVNVNYGATDQSLNRKKTQSVEPPKITPPNVDMFKNQMNEVE
EKLKEHTNFNKNKQSINFTEKTPFEKELEMKAQEMKNVNNLKNSQQMLIQQNKNSVQSIR
KDSADRVSGMTQEQIKLQKYKEDSISILKQLQESGNITESLIEAKQNTAKNNIIEFKKQS
TQKVTQAKVYQQVPDEIVTPSSHNQSNFTKKKASVLSSDISKLQNNFISEEKQEAMIEEF
KNKNSFIENDNRFYREEEEEDKDVIMITQEDERQIKDIVSDIDYKAFYGKVMKKTKNAET
DDDFKHLSPRSREIATVMKVISKSFKDADEPPITTTDFYRIGKMLGRGAFGKVNLAMHKL
VRKLVAIKSLNKECLTDEIQKQKLMKEVALLLKLRHNHVVKIYETIETEKHIIIVMELCA
GGDLLNYVRKRRKLKEPYAKFIFKQIIDGLCYIHSKYIAHRDIKLDNILLDGKGNVKIAD
FGISKKGTKGQKMTEQCGTPAYIAPEILKDKGYSFNIDIWSAGVVLFAMLYGTVPFKANN
MEELHKLILKGKYTLKDDISIEARNLLRGLLEVNPEKRLTIQQIYRHKWLSDVDPNLELF
NDQEKGMIKKEYTYNDPRRYNRNENEEPVDCFTEHHLESVYNSLKNATSKSIILAPFNST
QSQIDPMDQAEIQKLLCEKMMILNLARRCREIDRQYEFNNNGDLDNGVYHKYVYNSEDGD
NDSDNPENPDKLDGNSDLLSVPMLISERNEKRKGGRASVENSFENNSSIQQMQDRQALAK
KIKENSNIQKDFRNKRGSVIGSDLDNIDKDLVQTFETFQSKYSSKNDEEKVKQMVEFGYP
HDYVLKSLEESDPNYCTAGYYLLCMDQNYC