Identifiers and Description

Gene Model Identifier

Contig1072.0.g14

Standard Name

STK74

Aliases

Contig1072_0_g14

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010160705.998372506255629e-88Protein kinase domain containi
ng protein
SGDYGL179C1.9993430003514377e-39TOS3 SGDID:S000003147, Chr VII
from 165091-163409, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1072.0.g14(coding)
ATGAAATAAATCAAAATAAATGCCAAACTTTCACTCAGCAAGAAGTCTTCCAATAATGTG
CTGACAGGTTCTCTATCAGGAGAGAGTCCAAATCATTAAGTAATTGAAACTAATGAAGTT
GTTTAATGCTTTGATGAAAATGGTAGAAGGCAAGTGAATCAGTATGTGTTCTAAGAGACA
ATTGGACAAGGAGCTTTTGGCAAAGTCAAATTAGCACATTTAAAGGAGGATCCAACACAA
TTATATGCAGTGAAAGTGTTCAGAAAGTCTCAGCTCCTCAAAAAGAAAGAATATTTCAGG
AAAAAAGAGGGAGGAATGGGATTCAAGAGTTAACTCTCGAAAGTATAGCAAGAAATAGCA
ATTATGAAAAAGTTAGTACATCCAAACTTGATTCAACTTTATGAAGTTATTGATTATGAT
GAGGGGGACAAATTATACATGATCATGGATTATGCATAAAACGGAGAAATATTAAAGTGG
AACCAGAAAACTTGCAGATTTAGACCTTTCTAAAATGGATTAGACTAATTGCTTGAATCT
GATATTAAAAAATATATGCGTCATTGTATCAGAGGTCTTCATTTTATGCACAGCAACAAC
ATAGTTCATAGAGATATAAAACCCTAAAATATCCTAATTACCGATAATTTTAAGGCTAAA
CTAGGTGATTTTGGTGTGAGTTAGCTTTATGAAAGAGAAGAGGATGATAAAATTAGCAAA
ACAGAGGGCACTTATCACTTTATGGCACCAGAATGCTGTGATCCTGACGTTGAGAGTTTC
AGTGGAAAAGCAGCAGATATCTGGGCACTTGGAGTGACTCTATACTGCATGGTTTTTAAT
GAACTGCCTTTCTGGGATGAGACAGAGTTCGGTATCATCTAAAAGATTCACAAAGAAGAA
ATAAAAATCAGTGAGAGCAGGTAGATCTCGAAGGGTCTTAGACACTTACTTTCTCGCATG
CTTGAAAAGAATCCAGAGAAGAGAGCTTAAATTCAAGAATTGAGAGAAAATTCTTGGATT
AATGAGGGTTGCAAGACTGCACTTATACAAGAAGAGACAAGTTTCATTAGTGAATTGACT
GAAGCTGATCTCCAACATGCCTTGACACCAATTCACAGAATTGTTTTCGCTAAAAAATTC
GGCAAGCAATGA


>Contig1072.0.g14(protein)
MKQIKINAKLSLSKKSSNNVLTGSLSGESPNHQVIETNEVVQCFDENGRRQVNQYVFQET
IGQGAFGKVKLAHLKEDPTQLYAVKVFRKSQLLKKKEYFRKKEGGMGFKSQLSKVQQEIA
IMKKLVHPNLIQLYEVIDYDEGDKLYMIMDYAQNGEILKWNQKTCRFRPFQNGLDQLLES
DIKKYMRHCIRGLHFMHSNNIVHRDIKPQNILITDNFKAKLGDFGVSQLYEREEDDKISK
TEGTYHFMAPECCDPDVESFSGKAADIWALGVTLYCMVFNELPFWDETEFGIIQKIHKEE
IKISESRQISKGLRHLLSRMLEKNPEKRAQIQELRENSWINEGCKTALIQEETSFISELT
EADLQHALTPIHRIVFAKKFGKQ