Identifiers and Description

Gene Model Identifier

Contig866.1.g29

Standard Name

STK69

Aliases

Contig866_1_g29

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( pfam00675 ) Insulinase (Peptidase family M16)
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam05377 ) Flagella accessory protein C (FlaC)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010160704.001456298413176e-90Protein kinase domain containi
ng protein
SGDYGL179C3.000619078166531e-39TOS3 SGDID:S000003147, Chr VII
from 165091-163409, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig866.1.g29(coding)
ATGAAATAAATCAAAATAAATGCCAAACTTTCACTCAGCAAGAAGTCTTCCAATAATGTG
CTGACAGGTTCTCTATCAGGAGAGAGTCCAAATCATTAAGTAATTGAAACTAATGAAGTT
GTTTAATGCTTTGATGAAAATGGTAGAAGGCAAGTGAATCAGTATGTGTTCTAAGAGACA
ATTGGACAAGGAGCTTTTGGCAAAGTCAAATTAGCACATTTAAAGGAGGATCCAACACAA
TTATATGCAGTGAAAGTGTTCAGAAAGTCTCAGCTCCTCAAAAAGAAAGAATATTTCAGG
AAAAAAGAGGGAGGAATGGGATTCAAGAGTTAACTCTCGAAAGTATAGCAAGAAATAGCA
ATTATGAAAAAGTTAGTACATCCAAACTTGATTCAACTTTACGAGGTTATTGATTATGAT
GAGGGGGACAAATTATACATGATCATGGATTATGCATAAAACGGAGAAATATTAAAGTGG
AACCAGAAAACTTGCAGATTTAGACCTTTCTAAAATGGATTAGACTAATTGCTTGAATCT
GATATTAAAAAGTATATGCGTCACTGTATCAGAGGACTACACTTTATGCACAGCAACAAC
ATAGTTCATAGAGATATAAAACCCTAGAATATCCTAATTACCGATAATTTTAAGGCTAAA
CTAGGTGATTTTGGTGTGAGTTAGCTTTATGAAAGAGAAGAAGATGATAAGATTAGCAAA
ACAGAGGGCACTTACCACTTTATGGCACCAGAATGCTGTGATCCTGACGTTGAGAGTTTC
AGTGGAAAAGCTGCAGATATTTGGGCACTTGGAGTGACTCTATACTGCATGGTTTTTAAT
GAATTGCCTTTCTGGGATGAGACAGAGTTCGGCATCATCTAAAAGATTCACAAAGAAGAA
ATAAAAATCAGTGAAAGTAGGTAGATCTCGAAGGGTCTCAGACACTTACTTTCTCGCATG
CTTGAAAAGAATCCTGAGAAGAGAGCACAAATTCAAGAATTGAGAGAAAATTCTTGGATT
AATGAGGGTTGCAAGACTGCACTTATTCAAGAAGAGACAAGTTTCATTAGTGAATTGACT
GAAGCTGATCTCCAACATGCCTTAACACCAATTCACAGAATTGTTTTCGCTAAAAAATTC
GGCAAGCAATGGAAAATAAATGCAAGTAATAAAGCCATGCTAATAAAATAAAAATCAATT
GAGTAAGATGATGCTTCACCATTCGATGTTTAGCATTAAAATCCATCATTAAATTCTGTC
TAACTCTCAACAGCTTCATAAAATTCATAAATACAAAATGACTTTGGTAACCTAGACTTA
AATTAATAACAATAATGA


>Contig866.1.g29(protein)
MKQIKINAKLSLSKKSSNNVLTGSLSGESPNHQVIETNEVVQCFDENGRRQVNQYVFQET
IGQGAFGKVKLAHLKEDPTQLYAVKVFRKSQLLKKKEYFRKKEGGMGFKSQLSKVQQEIA
IMKKLVHPNLIQLYEVIDYDEGDKLYMIMDYAQNGEILKWNQKTCRFRPFQNGLDQLLES
DIKKYMRHCIRGLHFMHSNNIVHRDIKPQNILITDNFKAKLGDFGVSQLYEREEDDKISK
TEGTYHFMAPECCDPDVESFSGKAADIWALGVTLYCMVFNELPFWDETEFGIIQKIHKEE
IKISESRQISKGLRHLLSRMLEKNPEKRAQIQELRENSWINEGCKTALIQEETSFISELT
EADLQHALTPIHRIVFAKKFGKQWKINASNKAMLIKQKSIEQDDASPFDVQHQNPSLNSV
QLSTASQNSQIQNDFGNLDLNQQQQ