Identifiers and Description

Gene Model Identifier

Contig22078.0.g16

Standard Name

STK52

Aliases

Contig22078_0_g16

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJL187C1.0003081162615753e-33SWE1 SGDID:S000003723, Chr X f
rom 79262-76803, Genome R...
T. thermophilaTTHERM_001460806.0002282540086176e-27Protein kinase domain containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22078.0.g16(coding)
ATGCAAAACCTTTAATTGGATAATCCATTCGCCAAATCACTCGATCATCGGTTCATTGGT
TAGGATAGATTGACTCACTCACTGCAGTACCAAAATATCTCAATCTGCCCACTTACTCCC
TTCGAGTAGAGCAATTTGCAACTAGAGTGTTCGCCCAAGCATCTCACTTACTCCCCAGGG
GTTGATATGAGCAAGTCATTATAAGTTTATCTTTCAATACCAGAATATGGATTTTCTTCA
AAATTAATGAGCGCCAAAAAGCAAAAGCGTTTCGTGCCGAATACTCCAGCTAAGAAAAAT
CGTAGTCACGCTTCTCAAGAGCTATATTCACCATTCGCAAATATCCTTCATTTTTCAGAA
GAGTAGATGCCAAGCTCCAAACGGGATAATGACATCATAAATACTATTGGCGGACAAACT
TAATCAGGCATTCAATAAAACACTCAACAATAAAAGCGAATGAAAGTCACAACCATTCAA
CTCCAAAAAACCAATCGATTCCACACTGACTTCCAACTAATCTCAAAATTGGGAGAAGGC
AGTTTCGGAGAGGCTTTCAAAGTAAGAAGTATAGAGGATGGCTAACTCTACGCAGTGAAA
AAAGCTAAAGATAAGTACTAGGGTTACAGAGACAGAGAGCAGAAATTATTGGAGGTACAT
CGGGCTCTAAAACTAACCAAACTGGGATAAGAGACTAAGAAGTAAAATGCTGATTAAGTC
AAGTATTCAGATTCTTGTGTGCAGGTATATGAAGCCTGGGAAGAGAGCGGATATTTATAC
ATTAGAAGCGAGCTATGCGAGAAGGGAAACCTTAATGACTACCTGGTTGAATTAGAGAAA
CTACAAGAAAATGAATTGCTGAAGGAAGATGACATTTGGAGATTTTTATATCAAATGGCT
TGTGCTATAAAACATGTCCATGATTCAGGCTTCATTCATTTGGATATTAAACCATCTAAC
TTTTTCGTTATGTCCAATGGGAATATCAAGCTAGGTGACTTTGGTTAAGCAGTTGAGTTG
TGTAATCTCGCAAAGATCCGTGACGATGACGTTGAAGGCGATTCTGTCTACATGGCACCA
GAACTCCTTAAAAGTAACATAAAAGTGACTGATAGAATAACAAAGAAAGCTGACATATTC
AGTTTAGGAGCGTCACTGCTTGAGCTGGCCTCTGGAATGAATCTTCCTCAAAATGGGATG
ATGTGGTAGAAATTGAGACAAGGTGATTTGATTTAGTTTTCACCAAGCGCCGGTAGGTCT
TAGTAAATTGAATCTCTTATAAACTTAATGATGGATCCATGCCCAGAAAGCAGGCCAGAT
ATTGATGATATTCTTCTACACCCCAAACTCACTAATATTTAAGCTTCCATGAACCCCTCC
ATTAAGAGAAGCTTAAAACTTAATCATTTAGAGTCCCCAATCGTTGATAAGCTTAGAAAT
CCACTGTCAACAAAAAACAAGTCATAAGTTGAGCTTATTCTCATTTCCCCAAGAATCTTG
AAAAGCGCTTCCAAGCAAATTTAATATCAAAAGGTTACAAAGAATCAGAATTCAAGTGAC
TACAGTGGAGAACTTTATGATTAAGTAAAAGAAGACTATGGGGATGACGATTACAATTTT
CATAGCAATGACTTAGCTGAAAATTTGAGAACAGTCGGAAGGTCGGGTTCTTTTATGGAG
GATTAAAATGACAATTACAAGAATCTAAATTAATACTCTAATCAGCAATAGCATCAGAGC
ACCGCTCATACAAACAAACATGACTATCAACAAGCAGGTGGAGACCATGCTAGTCTCTAT
AAAAGTGCGAAAAAACTAAGATTTGAAATGGCTGACCAGAAAAACAAGAAGTTTGATTAA
ATCTCCTATAATGACGTAATACCTTTCAAAGCAGAGGGTACAGAGTAAGGAGTAGTTAAC
TACACAAATTTCTTAAACAGCAAGAATTTAAACAACCTTTTCGAGACAGTTGACGAAATC
ATGACTGAAGAAGACCACGAGAGCAAAAGCGTATCCATTCAGAGCTCAGGCAATCACTCA
AGCGGATATATAGGAAACAACCCTCAAAACATTTTCCAAGCCGTTCATATCAGCCAACTC
AAATTAAATGAGATGAACTCGTCAAAACCATTCTCATTTAATGAAAACTTTAACAGCATG
AACGCCTACTCTAATAATCCTGAGTAGAACCAATATCTGTAAATTACACCCCATTTATAG
GGAAAAGCGAGCATGCTTAGCAATATGAGCAGGACTAGTTCTAATAGTAACAGCGGTGGA
TTTTAACTCAGAAGTTCAAATGATAATAACAAGAGAAGAAAGAGAGCTGAAATTAGTAGC
AACAGTTTTGGCTTAAGCCATAATCATTAGCAAAACATAAACAACCACCAAAGTTGCAAC
ACAACAGCACACCCTAAGAACCGCAATTCCACAAACCCCTTCGAGACCAATGTGAATTGC
TTCAGTCTAGGTGGCTCTGCTAAAAAACGCTTGTTTTCGAACAACCCCTTCACTAAGCAA
GACCATTCTGCCTAATAAGCCTCTCCAAGTGTTGAGAGCTGGTAGCAGATGATAGTCGAA
GAAGACTAGTAAATTCAAAGCAACCTCCCAGATTCCATATTGGATAATAACAATTGTGAG
AGTGACTTTGAAATTAACAGACACAGTAATTTCAGCAGCAACAATATCAACATGGATTAG
TTAACTATGCTTCGTTAACAACCAATTGTATTGAGTAATTTTTCACAACTAGGTCAAGAC
ATTAAGAGAAACCTCTTCGATGCTTGA


>Contig22078.0.g16(protein)
MQNLQLDNPFAKSLDHRFIGQDRLTHSLQYQNISICPLTPFEQSNLQLECSPKHLTYSPG
VDMSKSLQVYLSIPEYGFSSKLMSAKKQKRFVPNTPAKKNRSHASQELYSPFANILHFSE
EQMPSSKRDNDIINTIGGQTQSGIQQNTQQQKRMKVTTIQLQKTNRFHTDFQLISKLGEG
SFGEAFKVRSIEDGQLYAVKKAKDKYQGYRDREQKLLEVHRALKLTKLGQETKKQNADQV
KYSDSCVQVYEAWEESGYLYIRSELCEKGNLNDYLVELEKLQENELLKEDDIWRFLYQMA
CAIKHVHDSGFIHLDIKPSNFFVMSNGNIKLGDFGQAVELCNLAKIRDDDVEGDSVYMAP
ELLKSNIKVTDRITKKADIFSLGASLLELASGMNLPQNGMMWQKLRQGDLIQFSPSAGRS
QQIESLINLMMDPCPESRPDIDDILLHPKLTNIQASMNPSIKRSLKLNHLESPIVDKLRN
PLSTKNKSQVELILISPRILKSASKQIQYQKVTKNQNSSDYSGELYDQVKEDYGDDDYNF
HSNDLAENLRTVGRSGSFMEDQNDNYKNLNQYSNQQQHQSTAHTNKHDYQQAGGDHASLY
KSAKKLRFEMADQKNKKFDQISYNDVIPFKAEGTEQGVVNYTNFLNSKNLNNLFETVDEI
MTEEDHESKSVSIQSSGNHSSGYIGNNPQNIFQAVHISQLKLNEMNSSKPFSFNENFNSM
NAYSNNPEQNQYLQITPHLQGKASMLSNMSRTSSNSNSGGFQLRSSNDNNKRRKRAEISS
NSFGLSHNHQQNINNHQSCNTTAHPKNRNSTNPFETNVNCFSLGGSAKKRLFSNNPFTKQ
DHSAQQASPSVESWQQMIVEEDQQIQSNLPDSILDNNNCESDFEINRHSNFSSNNINMDQ
LTMLRQQPIVLSNFSQLGQDIKRNLFDA