Identifiers and Description

Gene Model Identifier

Contig11718.0.g18

Standard Name

STK50

Aliases

Contig11718_0_g18

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005404103.0001382455732556e-90TPR Domain containing protein
SGDYLR362W1.9998745702418095e-48STE11 SGDID:S000004354, Chr XI
I from 849866-852019, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11718.0.g18(coding)
ATGGACTCTTTAACACTTATATAACTAGAACCTATTGATTAATCTAACAATAATAGCGTT
GATAATAAAGCCAACTAAACTTCTAACAATTTATAGAATCCTGGCTAGAGTAAACTTGCT
TAAAATTTTATTGGCTATACTGGCTTCACTTAGTAGAATGGTCTTGATCTTAATTTAAAT
GATGAAGACGTAGACTAGGATTTGAAAGAAAGAATAAGAAGAGATTCTCAGAAAACAATA
AAGCGAAATTGTTAATTAACTGAATTTATTCGAATTGGGGACTTACTAGGAGAAGGTGCA
TATGGAAAAGTTTACAAAGCTTTTAACATGCAAGATGGAAAGACAATTGCAGTTAAAGTG
ATGAAGATATAACCGCAAGATCAAAACGAATAAAAATTGATAAAACTAACATCAAATCTC
TAAAAAGAAATAACTTTGTTACAAAACTTGAAACACCAGAACATTGTGAAATATTTAGAT
TCATGCATTATTGATGACAGTGATGTTAATATCTATATGGAATACTTGCCAGGTGGATCT
ATATCTTCAATAATTAAGGAGTATGGGCCTATGGACGAAAGTGCAATCAGGCATTTCACA
AAATAACTACTTGAGGGTTTAAACTATTTGCATTAAAATCACATTATTCATGCTGATCTT
AAAGGGGGGAACATTCTCTTTGACGGACTGGACAACATAAAACTTAGTGATTTTGGAGCA
GCTAAATTTATTGAGAATATTTCAGCGCTCAGTGCTTCTTAATCCGATATATGCTAATCT
ATAAAAGGGAGTCTTTATTGGATGGCACCTGAGATGATAATGTAATAAGGCTATGGTAGG
AAAATTGATATATGGTCTTTGGGTTGTACAATTATAGAAATGGCTTCAGGCACTCATCCT
TGGCCAGATGTCAAAAATTATCCATAGTTAGTACTCGAAATAGTTAACAAAAGAATACCT
CTGATACCAGACCACTTGTCGGAAAATGCCCAAGATTTTATTCCACCCATTCATATAAGA
TATATCAGAATGAAGTGCCATAGAGTTACAATGGAGAAACCAGTAGTACAAATAAAGTCT
CCGCTTGATATGAATAGCATGACAACAAAGACAATTATTAAAAAAAGGGAAGAAGCTTTT
ACCTGGAGCTAAACAGACGATTCCATTACTCTTACATTCCCAATCAGGAATGTAACTTTA
AAAGGAATAGACGTTATATATACACCTGAGTTTATTAAGATTAATGTCACATCTTAGAAG
TTCGTCTCAATCGTAGATTTTGCACAACTTATTGATAATGAAAACCCTCAAAACAGAATT
CAGCTACAAGATGAAGGCCTTGAAGTATATCTAATGAAGGCTAGCAGTTCTAAGGGTCAT
TGGAACGAGATCTAACTAAGAGGCTAGTCTAAGTCTGAGCTCATAGCAAGAAGAGAGCAA
TCACTCTAGCAATACTATACTCACTAGGAAAAAAAATTCAAAGAAGCTGCAGATCTTAAG
GTCAAGATGGACAAAATGTCAATCGATCAGTAAATGAAAGTAGAAGATTTTCAAAGATCT
TAATTGAAAAAGATAAAGCAAGAGCAAAAACAACTTGCTGAGTAATAGCTTTACAACGAT
TTGGACAACCTTGAGCAGATTAATAGGAAACTTCTAGAACAAAAACATTAAAAAGATTAA
GATTCAAATTATTAAGACTAGAGCGCAGATTAAATTAAAATTAATAAAGACGATAAGGAA
AACGTTTAAAGTCAAGGAAACAGAGGAAATCATACAGTTATCCCTGAATTCAGAGGCGAT
ACTGGCTTTAGCTTTAAAAATAAGCAAGACAAGGATATCTTTGGAGACGAAGATGATATT
GAAACCATACCCACTCAATAGTAAAGAACTAAGAATCAGCATTCAAATGCTTAAACCAAT
AAAAGTAAAGACAACGAGACTTATGTTGAAGAAATAACAGAGGAACAGGCTTAGCTGATT
AACAGTTAGTTTGAAACTTAACTCGAAGTTGAAGTCCCTGTACCTCAAGTTCGTGGCAAA
TAAGATGTCACAGTACCCTTTACAGAGAAGAAGTTTCCAAATTTGCCAGCCAGAGAATCC
CACAATAAGGAGCCACCATACCCTAAGTCTAAGAAAATTGATAAAAAGAAAGATGATGTG
TTCATCGATATAGAGGACAAAGATCCAGTTTGGCTTAAAGATAAGGGAGATCACTTCTTT
AAACGTAATGACTTTTACTCTGCCCTCAATGCCTACTCTAAAGCACTAGAAATAGACAAA
GAGTTCATGATGTGCAGGCTTAACAGAGCTACAGCTTGGTTGAAGATGAGAGCCTTCCAA
AACTGTATTGATGATTGCACTGATATCGAAGTTTAAGTCTAAAACATCAAAGACAGTGAA
AGAGAAGACGAATTTTATCAAAAGCTTCTTGCTAGAGTTTACGTTAAGCGTGGAGCATCT
TATAGCTGGCTCAGTATGTTTGATAAAAGCGTTGATGAATTCAAAAAAGCGCTAGAGTAC
AAAGGAATATTCTCAGAGTTAGAATTAAACGAAATTGAAAAAGATATCGAGAAAATTATA
TCAAGAAAACAGTCTCAATAGTTGAAATAGGAAGGTGATATGAAGTTTGCCTAAAGTGAC
CTTGAAGGAGCGCTTGAAATGTACACTAAAGCTCTTTAATTAGATGATAAAAACGAATAT
GCACATGCCAACATTGGACTTATCCATATGAAGCGCTAAGATTATCAAAAATGCATAGAA
TTTTCTACTAGGGCCCTTGAGATATTAGATCATTTTATGAATGATACCAAGTCTTTCCAA
AGAGACAATAAATTGGAGGTAAAAATTCTCTTGAGAAGAGGGAAATCATTTGAAAATGTT
GGAGAATATGAAAAAGCAAAGGAAGATTTAGACAAAGCTATAGGTTTAGAACCTTAAAAT
GGCGAAGCAAGAACTCTTCTAAAGAAAGTTCAAGAAAAATTAGACGCGATTCTCTTCGAT
AAATACAACAAGCAAGCTATCGAATACTAGAAGCAGTAAAACTTTGCAGGAGCTTTGGAA
TTCTATGAAAAGTGTCTAAGAATAACTAAAAAGGGCACATCCCTAGACAATATAGCAGTT
TATGTAAATAAGATTGCTTGTTTGCTGTAACTAGAGAAGCATGACAGAGTAGTAACAGAA
TGTAACGATGCTCTTAGATTAATTAAGAACTTCAAAAATAAAAACGACGATAAGTAGACT
CCAGAAGATAAGAAGCGGTTATCTTAGATGGAGATCAGAGTTAGCGTGAGACGAGGCAAC
GCCTTAGCAAAATTAAATAGAGTCAGTGATGCGATTTAGGAATATGAAAGAGCCATTAAA
CTTGACCCTGAAAATGAAACAATCAAAAGAGACTTAGACACACTAAGAAAAGGTGCTTGA


>Contig11718.0.g18(protein)
MDSLTLIQLEPIDQSNNNSVDNKANQTSNNLQNPGQSKLAQNFIGYTGFTQQNGLDLNLN
DEDVDQDLKERIRRDSQKTIKRNCQLTEFIRIGDLLGEGAYGKVYKAFNMQDGKTIAVKV
MKIQPQDQNEQKLIKLTSNLQKEITLLQNLKHQNIVKYLDSCIIDDSDVNIYMEYLPGGS
ISSIIKEYGPMDESAIRHFTKQLLEGLNYLHQNHIIHADLKGGNILFDGLDNIKLSDFGA
AKFIENISALSASQSDICQSIKGSLYWMAPEMIMQQGYGRKIDIWSLGCTIIEMASGTHP
WPDVKNYPQLVLEIVNKRIPLIPDHLSENAQDFIPPIHIRYIRMKCHRVTMEKPVVQIKS
PLDMNSMTTKTIIKKREEAFTWSQTDDSITLTFPIRNVTLKGIDVIYTPEFIKINVTSQK
FVSIVDFAQLIDNENPQNRIQLQDEGLEVYLMKASSSKGHWNEIQLRGQSKSELIARREQ
SLQQYYTHQEKKFKEAADLKVKMDKMSIDQQMKVEDFQRSQLKKIKQEQKQLAEQQLYND
LDNLEQINRKLLEQKHQKDQDSNYQDQSADQIKINKDDKENVQSQGNRGNHTVIPEFRGD
TGFSFKNKQDKDIFGDEDDIETIPTQQQRTKNQHSNAQTNKSKDNETYVEEITEEQAQLI
NSQFETQLEVEVPVPQVRGKQDVTVPFTEKKFPNLPARESHNKEPPYPKSKKIDKKKDDV
FIDIEDKDPVWLKDKGDHFFKRNDFYSALNAYSKALEIDKEFMMCRLNRATAWLKMRAFQ
NCIDDCTDIEVQVQNIKDSEREDEFYQKLLARVYVKRGASYSWLSMFDKSVDEFKKALEY
KGIFSELELNEIEKDIEKIISRKQSQQLKQEGDMKFAQSDLEGALEMYTKALQLDDKNEY
AHANIGLIHMKRQDYQKCIEFSTRALEILDHFMNDTKSFQRDNKLEVKILLRRGKSFENV
GEYEKAKEDLDKAIGLEPQNGEARTLLKKVQEKLDAILFDKYNKQAIEYQKQQNFAGALE
FYEKCLRITKKGTSLDNIAVYVNKIACLLQLEKHDRVVTECNDALRLIKNFKNKNDDKQT
PEDKKRLSQMEIRVSVRRGNALAKLNRVSDAIQEYERAIKLDPENETIKRDLDTLRKGA