Identifiers and Description

Gene Model Identifier

Contig22170.0.g23

Standard Name

STK5

Aliases

Contig22170_0_g23

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001932007.001890014428386e-55Protein kinase domain containi
ng protein
SGDYGL180W2.9993743585281133e-40ATG1 SGDID:S000003148, Chr VII
from 160065-162758, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22170.0.g23(coding)
ATGAAAGCAGTCGGAAACTATCTGATTGAAAAAGTCAAGCTAGGAAATGGCTAGTATGGT
GAGGTATACAGGGCTCATTTAAAGACTGATGTTAACTAAAAATATGCAGTAAAGATTATC
AACAAGAAAAAGTTGGACACCAAACTGTTTGCCTACTTAAGAAATGAAATAGTATTACTC
TCAAAAATAGATAGTCCCAATGTTGTCAGACTTTATGACTTGCAGAGAACAGAGAATAAT
TTCTACCTCATCATGGATTACTGCAATGGCCTTGACTTGGAAAAGCTCAAAATGATAAGA
AAGAACTTCAGAGAAGTAGATGCGAGACTTATACTTCAACAAATAGTGCAAGGATTCAAG
GAGATTTACAAGCACAGAGTGATGCACAGAGATTTGAAGCTGGCAAATATACTTTTACAC
TTCAATTCTGACGACTTTGATTTCGACACCATGAAAGATGAAGTTTCTCGTAGCTAGTAG
AGACAAAGGTACTTCTAGAATGTTGATCTCTCAAAGACTTCCTTTTTAGTCAAAATCGCG
GATTTAGGCTTCGCAAAAGAACTTGGTTATGAGGACTTATCCAGTACATAATGTGGTACA
CCTTTGATTATGGCCCCAGAAATCTTGAATGGAAACAATTATAATCATAAAGCTGATGTA
TGGTCACTTGGAGTAGTCTTTTTCGAAATGCTTACCGGTTTCACTCCTTTTAATGGAAAC
GATAAGCCAGATCTGATTAGAAACCTTACTAAGGGAGATTACATGCTTCCTAAGAAAATC
AAACTTTCCTTACAAGGACTGGACTTCTTGAACTGCTGCCTGTAGCACAATCAGGAAATG
AGAATGTCTTGGACTGAGTTAGTCAATCACCCTTATATCACTTCAGACCCAAGAATGGAA
AAGCCTGAGGAAGAGCTTAAACTTCAATACTCAGAGATTCAAGGTCAATATATGGCTGAT
GAAATGAGCAATTCTCGAAATGCGATTATCCTTAACTGTAGAGACCCAGGCAAGTATATG
AAGGTGTATGAGGAAGTCCTTACTAAGCATTTTAAGCAGCAGTAAGAGCAGAGGGAGAGC
ATGATTAACTAACATGCCCAGCAAGTTAAGCAAGAGGAAGCTGACATTGTCGACAGGTTG
AAACTGTCAATGGCTAGATTTGACAACGGAGAGGAAGAGAAAAGCGATGACGAGATGTAC
TTTGACGTCAAGGACTAGATAGTCTAGCCACAAGTTAATGCACATCATCAAGTCTTTGAG
GAAGTTAAACTTGACCACAATAACTATGAACAGGATCTACCTCCCAAACAAGAAATAGTC
AAAAGTGTACAGAAATTGGAGGAACCTTATTAACCTCCAAAAGTAGTTGAAAATGTAAAG
CCAGTAGAAAGTAAGGTCAAAGTAGATGTAAGCAAGAATGAGAAGTTAATCATGCCCACT
AATTAACTGGTGTTCAACTCCAACAAAGTTGATGATGACACTGAGGCTCTTGATATAGAT
CAAATAAACAACTATTTGAATAACTAGGTGCAACTCCAGTAAAACGATGATTAATTTGAG
TTTGACTAGAATATTAACTTAGGAAGGCCAGTTAACTAAAACAGTCCTCAAAAGCAAGCT
TCTTCAATTCATAATCAAAGTCCACTCAAACCCCAAAGCTAATTAAAGGAATAAGAAAAT
GATAAATCGTGCGTTAATGTTGCAGGTGGTAACAGATCAGACGAGGAAGAACAGTTTGCC
AGTAAATTTGAGGAAATTAAACATCATGATGTTGCTGATGATTAAGGGTTCAAAATTTCA
CAAAGCAAATCGAATGGAGCTCATTAAGATGACATGTCAGCAACTTTGGTTGAAAGACCA
AGAGATGAAGAGTACTACCGTCACTAGAACCCACTCTATGAAGAGCCAGTCGATGTTGTG
AAAGACTCAATCTTCCCTCAGTTAATGAAGCCAGACCAGAACGACTAGCAAGCTATTCTC
TTTGACCAACAGCAAGAGGAAGATGTCAGCATCAACTTCAATGAAAATTATTTCTGA


>Contig22170.0.g23(protein)
MKAVGNYLIEKVKLGNGQYGEVYRAHLKTDVNQKYAVKIINKKKLDTKLFAYLRNEIVLL
SKIDSPNVVRLYDLQRTENNFYLIMDYCNGLDLEKLKMIRKNFREVDARLILQQIVQGFK
EIYKHRVMHRDLKLANILLHFNSDDFDFDTMKDEVSRSQQRQRYFQNVDLSKTSFLVKIA
DLGFAKELGYEDLSSTQCGTPLIMAPEILNGNNYNHKADVWSLGVVFFEMLTGFTPFNGN
DKPDLIRNLTKGDYMLPKKIKLSLQGLDFLNCCLQHNQEMRMSWTELVNHPYITSDPRME
KPEEELKLQYSEIQGQYMADEMSNSRNAIILNCRDPGKYMKVYEEVLTKHFKQQQEQRES
MINQHAQQVKQEEADIVDRLKLSMARFDNGEEEKSDDEMYFDVKDQIVQPQVNAHHQVFE
EVKLDHNNYEQDLPPKQEIVKSVQKLEEPYQPPKVVENVKPVESKVKVDVSKNEKLIMPT
NQLVFNSNKVDDDTEALDIDQINNYLNNQVQLQQNDDQFEFDQNINLGRPVNQNSPQKQA
SSIHNQSPLKPQSQLKEQENDKSCVNVAGGNRSDEEEQFASKFEEIKHHDVADDQGFKIS
QSKSNGAHQDDMSATLVERPRDEEYYRHQNPLYEEPVDVVKDSIFPQLMKPDQNDQQAIL
FDQQQEEDVSINFNENYF