Identifiers and Description

Gene Model Identifier

Contig14799.0.g110

Standard Name

STK49

Aliases

Contig14799_0_g110

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam03232 ) Ubiquinone biosynthesis protein COQ7
  • ( pfam01210 ) NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004202201.9992362000979228e-56Protein kinase domain containi
ng protein
SGDYJL095W1.999385218781115e-51BCK1 SGDID:S000003631, Chr X f
rom 247255-251691, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14799.0.g110(coding)
ATGGGCTAGGTCTGTGTCAAAAAAGGCGTTGACGTCAAATTTATCAATAATACCACTCAA
GACTTCAACACCTTGCAAGATAGCATTAATTTGCAATAAAATAAATTAGATGGGAGTGAA
AATTTTCAAAGATATGGGCGTTCACAGTTTTCTCGCAATGGGAAAGCCACTAGAATTACA
GGGTATTAAACTCTTACCAGAGAAGAAGGCAGATTAATCTCTTCTGCCATTTATAACAAA
AATTCAAGACATCCTGATGAAAATGACTTGGTAGTTGAGGATATAGATGGAAATGAGTAA
ATCCCCACTCGCAATGGAAATGAAATTAATATCGAGGATATTGAGAAACATAAGCAGAGG
TTCCGCAAAGTAATCAAAAATAAGAGAGTGCGAAATAACATCATTACAAACACAATGGAC
AATTATAAATTTGAGAATGGATTGGCGACGCCAATCGTCGGGAGAGGAAATGCTTCTGCA
GCTTTTGCATCATTTGACAACTCCAATGGGCACAACACTTTCCAATTTAACACAAATGAT
AATATGAACACTCTCGATAACTCATAGCACAATGAAAAGAAGAAGAAAAGAAAAGTCATG
CTAAATCGTAAAAGAGTGCAATCCCTGCATTAAGACAAACTAATGATATTGAAAAATCAA
AATACTCCAGGAACTAATAATAATTTCACTAATTATAATAAAAATGATAATGATTCGTCT
TAAGATAGAAATCAGTAAAACGGCTAATCATCTGGAAATTACTCTCAAAGTCAAGATGCA
AGAAGCTCCAACCCTAAAATAGAGTTTCAAGATCACAACAACTTACAAGGATATAAAGAA
GGAAATGACAATTTGATTATACTAACCAAGGAATCTATTGGAGATTCAACGCAAGCTTTC
ACTAATGTTCATAATACTCTGAATAAGTCATCTGCTTTTCAAAGTGGGAGTGATCATTAA
TAACCTTATAACAATAAATCTCTAACTAACAACCCAAATAGCCCGAATAAATCTTTATCA
GTAGATTAAACAGGCAAAAAAAGAGTGAAAAAAATTGGCTTGAGAGCAGCTGGTACCTTC
TCTTTAATGTCAGGAATTAATAACCAATCAAGAAACGTAACAAACTTTCAAACTCCATAA
TTTGCAACTGAGGTCACCCCTAATAAAAACTAAGATAACTTTAAAGCCACACAGCAGAAA
TGGAGGCTTTAATTTAAATAGGACTGCTATGACAGACTAAATTCAAGAAAGTATTGCTGG
GTTATCAAATACATAGCTAAACGTAAAAACTAAAAATAATAGTGGGAGTCACAGGAGAGT
CACAATCACCCAATTTCTACACCCTAAGTGACTAAAATTGTTAATAATCCCAGTCCACTT
AAGTCAGTGTCTAAGAAATAAGTAAGATAAGTCATTCAACAATATAACCAAAAGATGAAT
CCATAACAACTGCAATAATAGCAACAATAATAATAATAAATAATGCATTAAAAGACTTAT
ATCCAACCACAAATTGACCCAAACTAATTAAGTCATTAATTGAGCAATAATTATCAGCAA
TATTAACATTAACTTTCTGTAATATCTGGCAATAATAACTACAACCAATCTCAATACTTA
AAGTAGGGAAGTGTTGTAAGTCAAATATCATCTCGCATGCAAAGTCCTGTCAAACAAAAC
AAAAAACTTAGCATTTAAAATTTAGATTCAGTTTCAGGAGTTGGATATGAATATGAACGC
ATGAACTCAATAATTTCCGATAACTATTCCAGACAAATAAGTCATCTAATTCAAGAATAA
TATATTGATGGTAGAGAGGATGGCGAGAAAATCCAATATTCTAAGGGAAATATGATAGGA
CAAGGAGCTTATGGTTAGGTATATTAAGTACTCGATATGTACACAGGGCAGTTACTAGCT
GTGAAGTCTATAAAATTTTCTGATTCAAACAAATAAAAGGATATGATTAAAGAGCTTAAT
GAGATCAAGAATGAGATACAAATGCTTAGAACTCTAAAGCATCCAAATATTGTTCACTAT
TTTGGTACTGAAATCAGTGATGACAATCAAGGTGTTGATATCTTACTAGAATTTGTACCA
GGAGGTTCAATTCGTCAGTTGCTCGATAAATTCAAAGAATTCGATGAGCGTCTCGTCAAA
ATCTACACTCGTTAAATGTTAGAAGACTTAAAATGTGCAAACGTACTGGTTGACAACATG
GGTACAATTAAGCTATCAGACTTTGGTGCAAGCAAGAAAATTATCTAGACATTCGATAAT
AACCCAGAAGGTTTAACAAAAAGCGTCATTGGTTCACCGTTTTGGATGGCACCTGAGGTC
ATTGATAAGAGTGGATATGGAAAATCTGCTGATATATGGGGTCTAGGATGTTGTGTACTT
GAAATGTTATCATCACAGCCTCCTTGGTCTGAGTTTGGCAGTGATGCAAAAGTCATTATG
AATATTATATCAAACGCTAAAAAGCCACCCACATATCCTAATAATATCTCTAGGGAATGC
AAATAATTCTTGGACTATTGCTTTGAAAGAGATTAAACTAAAAGACCGACAGCAAATGAA
TTACTGGATCATCCATTTGTGTTGATGAAAAATCCCAAGGCCTTATAAGAAAGTATAGAA
GCAGCTAAATTGATGCAAAGTCATATTGGATCAGTCTACAATATGGGAAATACAAGTTAA
ATGTCTGGTTATCACAACTTCAACCCTCAACTATAACATCAATTGTCAATAATGAGTGGC
AGAACTTAAAACATGGGTTCATAAATGAATATGTCAAACCTTTACGTTCCAGATTAATTT
CAAAACAATAATCATCTGTCAACAAAAGTGGGAGAAGGCATTAAAAGTGCAGTATACCGT
TCTAATACTCATGGACAACCTTAATTGAATCATTAAGTTTCGAATGTACTATCAACGAAT
CAAAATTTAAATCTGAACACCGCGTATGGACATAATCCTTTCTAGTAGCAAGCAGCTTCA
CATTTGGGCGTAAATAGATTGACTACTTTCGCTGATAAACTTAAAAACCAAAATTAAAAT
TAGAAGCTAGTAAGAGAAGATATAGCCATGCAAAATTGGGTGAGAAGTGATACTCTTATG
TCAACTATGCAGTAGTTTAATATGTTAAAGTCTAATCATTAAAATGGTCCTGAAACCAGA
CCTCCCCCAACTATTCAAGAAACTAGCAACAACTTAAATCCTCCTGCTCCATAGCAACGA
AGAATCGGAAGCAATACATAGAACAGAAGAGCTCAATGA


>Contig14799.0.g110(protein)
MGQVCVKKGVDVKFINNTTQDFNTLQDSINLQQNKLDGSENFQRYGRSQFSRNGKATRIT
GYQTLTREEGRLISSAIYNKNSRHPDENDLVVEDIDGNEQIPTRNGNEINIEDIEKHKQR
FRKVIKNKRVRNNIITNTMDNYKFENGLATPIVGRGNASAAFASFDNSNGHNTFQFNTND
NMNTLDNSQHNEKKKKRKVMLNRKRVQSLHQDKLMILKNQNTPGTNNNFTNYNKNDNDSS
QDRNQQNGQSSGNYSQSQDARSSNPKIEFQDHNNLQGYKEGNDNLIILTKESIGDSTQAF
TNVHNTLNKSSAFQSGSDHQQPYNNKSLTNNPNSPNKSLSVDQTGKKRVKKIGLRAAGTF
SLMSGINNQSRNVTNFQTPQFATEVTPNKNQDNFKATQQKWRLQFKQDCYDRLNSRKYCW
VIKYIAKRKNQKQQWESQESHNHPISTPQVTKIVNNPSPLKSVSKKQVRQVIQQYNQKMN
PQQLQQQQQQQQQIMHQKTYIQPQIDPNQLSHQLSNNYQQYQHQLSVISGNNNYNQSQYL
KQGSVVSQISSRMQSPVKQNKKLSIQNLDSVSGVGYEYERMNSIISDNYSRQISHLIQEQ
YIDGREDGEKIQYSKGNMIGQGAYGQVYQVLDMYTGQLLAVKSIKFSDSNKQKDMIKELN
EIKNEIQMLRTLKHPNIVHYFGTEISDDNQGVDILLEFVPGGSIRQLLDKFKEFDERLVK
IYTRQMLEDLKCANVLVDNMGTIKLSDFGASKKIIQTFDNNPEGLTKSVIGSPFWMAPEV
IDKSGYGKSADIWGLGCCVLEMLSSQPPWSEFGSDAKVIMNIISNAKKPPTYPNNISREC
KQFLDYCFERDQTKRPTANELLDHPFVLMKNPKALQESIEAAKLMQSHIGSVYNMGNTSQ
MSGYHNFNPQLQHQLSIMSGRTQNMGSQMNMSNLYVPDQFQNNNHLSTKVGEGIKSAVYR
SNTHGQPQLNHQVSNVLSTNQNLNLNTAYGHNPFQQQAASHLGVNRLTTFADKLKNQNQN
QKLVREDIAMQNWVRSDTLMSTMQQFNMLKSNHQNGPETRPPPTIQETSNNLNPPAPQQR
RIGSNTQNRRAQ