Identifiers and Description

Gene Model Identifier

Contig9850.0.g9

Standard Name

STK46

Aliases

Contig9850_0_g9

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam08317 ) Spc7 kinetochore protein
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam12072 ) Domain of unknown function (DUF3552)
  • ( pfam07387 ) Seadornavirus VP7
  • ( pfam01496 ) V-type ATPase 116kDa subunit family
  • ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
  • ( pfam10009 ) Uncharacterized protein conserved in bacteria (DUF2252)
  • ( pfam04904 ) NAB conserved region 1 (NCD1)
  • ( pfam03961 ) Protein of unknown function (DUF342)
  • ( pfam03938 ) Outer membrane protein (OmpH-like)
  • ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
  • ( pfam02388 ) FemAB family
  • ( pfam04111 ) Autophagy protein Apg6
  • ( pfam04791 ) LMBR1-like membrane protein
  • ( pfam14362 ) Domain of unknown function (DUF4407)
  • ( pfam04156 ) IncA protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004677402.999657490030741e-141Protein kinase domain containi
ng protein
SGDYAR018C1.0000521619018958e-77KIN3 SGDID:S000000071, Chr I f
rom 171703-170396, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9850.0.g9(coding)
ATGAGCAACATGGATAAATATGAGAAAATCTAAGATATCGGAAAGGGTTCCTTCGGTTGT
GTGTCAAAGATCAGAAGAAAAGCTGATTAAAAAGTGTTGGTGTGGAAAGAATTAAACTAT
GGAAAAATGAGTGAAAAAGAGAAGCAAATGATTGTTTCTGAAGTCAACATCCTCCGTGAA
CTTTCTCACCCAAACATAGTGAGATATTACGATCGTATTATTGATAGAGAGTCGGCCAAG
ATCTATATTGTTATGGAATTCTGTGAAGGAGGTGACATAGCCTCACTCATTAAAAATCAC
AAGAAGGAAAAGAATTACATGCCAGAGGAAATTGTTTGGAGTGTCCTCGCATAAATGCTA
CAAGCTTTAGGCGCTTGCCATAATCGTAAGGAGGGTAAAATCTTGCACAGAGACTTGAAG
CCTGGTAATATATTCTTGGATAAGAACCAAAATGTTAAACTTGGAGACTTTGGATTGTCA
AGAGTAATGAATTAGGATTCAGTATTTGCTTATACTCATGTAGGCACTCCTTATTACATG
AGTCCAGAGCAGATCAACGACCAGAAGTACAATGAAAAGAGTGATATCTGGAGCACAGGT
TGCATCATTTATGAAGTAGCTGCCCTTCGAGCTCCATTTGAAGCAACAACTCATTATCAA
CTCGCCATGAAAATAAAGTCTGGAAAGTTAGATCGCATTCCTTCAACTTACACAGATGAT
CTCTGGAGAATAATTACATCTATGATTCAGTAGGACCCTGATCGTAGACCCTCTGTTGAT
GAACTACAATAACATCCTCAAATTTAAGTCAGAGTCAAGGAAGCCAAACTTCGATAGTAC
AGAGAGAATCTCAAGCGTAAGGAGCATGAAATGCAAAAACGTATTCATGTTATCAAAGAA
AAAGAGTAAGAAATTTCTAAAAGGCAGGCAGAACTGAAAGAAAAGGAAGAAAGATTAAAA
GCCCTAGAGAAGCACATCGAAGAGCAAGAAGAGGAACAAAGAAGGCAGCAGCAATTATAA
CCTTAAACAGCCACTGCCATCGGGAGTATAAGAACCAACAACCTCGAGAACGAAAGTGCT
AATTTACAATGTTAGAGCAACGATGGAGGGGTGGCTCCAGTCAAAGTGAACAGCAGCTTC
AAATCTAGGAGAGGCAGCTTCAAGCAGGCACTTGAGGATATAACTAATAAATTTGAAAAT
TAATACCTCAAGTGA


>Contig9850.0.g9(protein)
MSNMDKYEKIQDIGKGSFGCVSKIRRKADQKVLVWKELNYGKMSEKEKQMIVSEVNILRE
LSHPNIVRYYDRIIDRESAKIYIVMEFCEGGDIASLIKNHKKEKNYMPEEIVWSVLAQML
QALGACHNRKEGKILHRDLKPGNIFLDKNQNVKLGDFGLSRVMNQDSVFAYTHVGTPYYM
SPEQINDQKYNEKSDIWSTGCIIYEVAALRAPFEATTHYQLAMKIKSGKLDRIPSTYTDD
LWRIITSMIQQDPDRRPSVDELQQHPQIQVRVKEAKLRQYRENLKRKEHEMQKRIHVIKE
KEQEISKRQAELKEKEERLKALEKHIEEQEEEQRRQQQLQPQTATAIGSIRTNNLENESA
NLQCQSNDGGVAPVKVNSSFKSRRGSFKQALEDITNKFENQYLK