Identifiers and Description

Gene Model Identifier

Contig21594.0.g64

Standard Name

STK39

Aliases

Contig21594_0_g64

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam13779 ) Domain of unknown function (DUF4175)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004362506.001502944943701e-53Protein kinase domain containi
ng protein
SGDYGL180W2.0008536325002377e-42ATG1 SGDID:S000003148, Chr VII
from 160065-162758, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21594.0.g64(coding)
ATGAATTCTGAGTAATCCAATAATACTTCAAAGCAATCATCTTCCTAACCCAAAAAACTT
AAGAAAATCGGAAGCTACTCAATCAACTTAAACTGTATATTAGGTAAAGGAGCATTTTCA
ACTGTTTATAAAGCTTCTCAAGAAGGAGGGATAGACGTAGCATGCAAAGAAATTTCAAAT
GAAACTCTATAAAAATAGCTGGGTTCGAAGGCAGCGGAAAGTTTAGACAAAGAATTAGGA
ATTATTCAAAAATTGAGGCATAAAAACATAGTGTAATACGTCACTTTTCTTAGAACAGGA
AATAATAACTACATCTTCATGGAATTTTGTGGCGGAGGAGACTTAAGAACCTTTTTGAAA
GAAAAGCGAAGGCTTACAGAAGCATAAGCTTAAAAGTTTATGTATTAGATTGGGTAGGCA
CTCAAATATCTTTATCAAAATTCAATTGTGCACAGAGACTTGAAACTCTAAAATATCCTA
CTAAGCGATAAGACTTTTGATGCAGTAATCAAACTTGCAGATTTTGGTCTTGCTAGACAA
TACCAGACTAAAGAAGACCTCTTCGAAACCACCTGTGGAACTCCCATTTATATGGCCCCA
GAAATTTAAAAAGGTGATTCTTATGATGAAAAAGCGGATTTATGGTCCGTAGGAGTTATA
CTATTCGAGCTTATTGCAGGTTTCCCACCTTTCAATGGCAGAAGTAAGGATGAGCTCAAG
TAAAACATTGCCAAGGGCTAGTATGCATTCCCACCAGGAGTTTAACCCTCTATGATTTGT
ACTGATTTAATGAAAAAGCTGCTGATCTCTGATTCAAGCAAAAGAATAGATTGGCTAAAT
TTCTTCGAGCATCCCTTCATAAAGTCCTTGCCTCAATATTATGAAAGTTTGGTTAGCAGG
TATGACACTTCATAAACTTCTAGATTTTCTGAAGAAATTAAAATTGAAGAGAATGATATC
TAAAATTAGGATAAGGTGCATTAGAAGCCAGATATTAAATAGTAGTAAAAGTAGGAAGCT
CAAATAAAACCTAAAAATAGGTATTAAGAGTAAAATATACAATTAAACAATTAAAATGAG
CAAATTACTCATTAAAAAAACTCAGCTAATGTTAGAGCAGTAGAAGAACGGGAAAATTAA
GCTCAAGTTACAGCAAATTCAGACTCGATCGAAGCTCAGAATCGAATTATTAGCAATTCT
AATGAATCTTTGACTTAAGAGGATCTAGAGGAAGCATTGGATGATACATATAAGGCAATC
GAGAATTTGATAATGAAATGTCAATTTGCCTTGAAACTTATAGACACTGAGATCTATGAC
TCTAAGTTACAAACATTTTGCGATGTGAGTGATAACGAAAAAGAGATGAAGTTCATAATA
TACAGCTTAATTATGGAATTAAAGAGCCTCATTATCATTATTTGCTAAAAAGATTTTATC
AATGAGATGAAAGACGAAAATCTAGGCATTTTAGCAGAAAAGATAAGGAAATAATAGGAG
AAACATAATGACTACATTCTCGAAGAGGAAATGGAGGCCAAGTCCTTGAGAATATTCTCT
ACATAACCCAAGGAAATCAAGTTTACTCAGTATTTTATCTAAAAGCTGATAGAAAAGTTT
GGAGAAAAGCTAAAGAAAGTTTTAAATTATTGCTTTGATTTTTACCTTGGCCTCATGGAT
TTTATGATTGATCTTGGCTATGCAATTGAGAAAATTGACATCAATTAGATCGGTGAAGAT
ATGTTTAAGATTTCCCTCTCTATCATGTAATAAGCAGTAAACTCGTAACATTTACAAGAT
TACGAAACTGCAAAGTAAAAATACCAAAATGCCTCTTTTATACTTGAGGAATTAATGAGA
TTAGTTACGTGTCATAATGGCTTGGACTCTTCAAGCATGCTAGGTTAGCCAGTTGAACTG
TCTATTAAAAATTAAAATTAGAAAAAATTATTAGGAGGCAAGGAGTAGGATTTAGAATTG
ATCAATAAACAACCAGCTAAAAAAGCAGACACTAAAACAAAGTTAAAGAATCACACTCTT
CAAAAGAATTCTAAAATATTCACTTTTATTCAAAATCAGAAGTTTAAAGTAAAAGTGGGT
TAGGAGATTGAGTCTGGCATCTATAAACTTCACAAATAATTAGAGAAAAGAATATCAGCT
GTGGATTCAAACTTGCAACTGCATAATTTAGTTCAAGAAAAGTCAAAAACATGA


>Contig21594.0.g64(protein)
MNSEQSNNTSKQSSSQPKKLKKIGSYSINLNCILGKGAFSTVYKASQEGGIDVACKEISN
ETLQKQLGSKAAESLDKELGIIQKLRHKNIVQYVTFLRTGNNNYIFMEFCGGGDLRTFLK
EKRRLTEAQAQKFMYQIGQALKYLYQNSIVHRDLKLQNILLSDKTFDAVIKLADFGLARQ
YQTKEDLFETTCGTPIYMAPEIQKGDSYDEKADLWSVGVILFELIAGFPPFNGRSKDELK
QNIAKGQYAFPPGVQPSMICTDLMKKLLISDSSKRIDWLNFFEHPFIKSLPQYYESLVSR
YDTSQTSRFSEEIKIEENDIQNQDKVHQKPDIKQQQKQEAQIKPKNRYQEQNIQLNNQNE
QITHQKNSANVRAVEERENQAQVTANSDSIEAQNRIISNSNESLTQEDLEEALDDTYKAI
ENLIMKCQFALKLIDTEIYDSKLQTFCDVSDNEKEMKFIIYSLIMELKSLIIIICQKDFI
NEMKDENLGILAEKIRKQQEKHNDYILEEEMEAKSLRIFSTQPKEIKFTQYFIQKLIEKF
GEKLKKVLNYCFDFYLGLMDFMIDLGYAIEKIDINQIGEDMFKISLSIMQQAVNSQHLQD
YETAKQKYQNASFILEELMRLVTCHNGLDSSSMLGQPVELSIKNQNQKKLLGGKEQDLEL
INKQPAKKADTKTKLKNHTLQKNSKIFTFIQNQKFKVKVGQEIESGIYKLHKQLEKRISA
VDSNLQLHNLVQEKSKT