Identifiers and Description

Gene Model Identifier

Contig18833.0.g92

Standard Name

STK33

Aliases

Contig18833_0_g92

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( pfam10707 ) PhoP regulatory network protein YrbL
  • ( pfam11959 ) Domain of unknown function (DUF3473)
  • ( pfam01636 ) Phosphotransferase enzyme family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000112201.9992982665753866e-121Protein kinase domain containi
ng protein
SGDYOL016C1.0000310450948521e-65CMK2 SGDID:S000005376, Chr XV
from 296120-294777, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18833.0.g92(coding)
ATGTAATTTAGAGGTTCATTCTCAATTATGAGGCAAGGAATTAATAAAAAGACAGGCCAG
AAAGTTGCAATAAAAATCATTCACAGGGAGTCTCTTGAAGAGGAAGACGAAATTGCATTG
CAAACAGAAGTTGAAATCTTATCGCAAGTTGATCATCCAAATGTGGTTAAATTGTACGAA
ATATTTGACAATAAAGATTGCATGTTCTTGGTTTAAGAGCTTATGTCAGGGGGTGAGCTG
TTCGATCGAATAGTGGAAAAAGAATAGTATTCAGAAAAAGAAGCTGCTGATACTATTAGA
CCGATAGTTGATGCTGTCAGATATTGCCATAGTATGGGTATTATTCATCGTGATTTAAAG
CCAGAGAATTTGTTATATGCATCGAGAGACAAACAATCGATAATTAAGATTTCAGATTTT
GGTCTTGCTAGATTTTTGAATGGGGAATTGGCATTCACGGCTTGTGGTACTCCTGGCTAT
GTTGCCCCAGAAATTCTATTAGGATTGGGCTACGGAAAAGAGATTGATTATTGGAGTATT
GGAGTAATACTTTATATTTTATTGTGCGGATTTCCTCCATTTTACGATGAAAGCAATTAA
AAGCTGTTTGAAATAATTAAACGCTGTGAAATAGACTTTCCATCGCCTTTCTTTGATGAT
ATCTCTGACATGGCGAAGGATTTAATCAGATCTCTACTTGTGAAAGATCCATAAAATAGA
CTAACAGCAGAGTAGATTCTAGATCATCCCTGGATGGTAGGCAAGGACACCCCTCGCACC
GAGCTCCCTCTCGTCACTCAATACATGAAGGAATTCAACACTCGCAGGAAATTCAAGAGA
ACCACTTATTTAGTAATGGCTGCAGTTAGATTCTAAAACATCCTAAAACTAAAAGGTTGA


>Contig18833.0.g92(protein)
MQFRGSFSIMRQGINKKTGQKVAIKIIHRESLEEEDEIALQTEVEILSQVDHPNVVKLYE
IFDNKDCMFLVQELMSGGELFDRIVEKEQYSEKEAADTIRPIVDAVRYCHSMGIIHRDLK
PENLLYASRDKQSIIKISDFGLARFLNGELAFTACGTPGYVAPEILLGLGYGKEIDYWSI
GVILYILLCGFPPFYDESNQKLFEIIKRCEIDFPSPFFDDISDMAKDLIRSLLVKDPQNR
LTAEQILDHPWMVGKDTPRTELPLVTQYMKEFNTRRKFKRTTYLVMAAVRFQNILKLKG