Identifiers and Description

Gene Model Identifier

Contig22783.0.g18

Standard Name

STK23

Aliases

Contig22783_0_g18

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010160704.001670058321624e-73Protein kinase domain containi
ng protein
SGDYGL179C4.9998290395614495e-40TOS3 SGDID:S000003147, Chr VII
from 165091-163409, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22783.0.g18(coding)
ATGGAAAAGTAACTTCTCAGAGACATAAAACAGAAACATAAGGGATTTCATACAATTAAT
TAGTATTCAATTATCAAAGAACTTGGATAGGGGTCATATGGTGTGGTTAAGCTTGTGCAA
AAAAATGAAACTCTCGAGAAATTTGCAATGAAAATGTTTTGGAAATCTAAGCTAAAAAGG
GAGAAGGAATTTATTAAATAAGACGACGATGGGTAGTTAATTGTAAAAGATGCTCTTCAA
GATGTACTCAGAGAGATTGAAATCATGAAAGAACTGGATCACATAAGTTTAATTAAACTA
CATGAAGTTATAGACGACTAACAAGACAAACTCTATATGATTATGGATTATGCATAATAT
GGGCAAGTAATGAATTGGGATGTAGAGGCAAGACTATTTTCTCCCTGCGTTAGTGATAAA
GAATGCTTTTCAGAGAAGGATATTTAGAAGATTTTAAGGGACTGTATAAGAGCATTAGAT
TATATGCATTAGAATGGAATAGTTCATAGAGATATCAAACCTCAAAATATAATGTTAGAT
GAAAATGGAATTGCCAAAATTGGAGACTTTGGATGCAGTATATAATTTCAAAATGGGAAT
GATACAATGCAAAACACTATAGGAACTTATTAATTTTTCTCTCCAGAGTGTTGTGACCCT
GACATAAAGACCTTCTCTGGAAAAGCAAACGATGTCTGGGCTCTTGGAATAACTCTCTAT
GCCTTGATTTACAACGAATTACCCTACTGGGCAGAAACTGAGATGCAAGTCTTAGAAGAA
ATTCTTACAAAAGAAATCCAATATCAAGATAAAAAGAGACAAGTGTCTGATGGTTTGAGA
TTTATACTTATGAGAATGCTTGAGAAAAATCCTAAGAAAAGAGTGACACTCAAAGAACTT
AAAAGAAATTCGTGGCTTAACGATGGATACACTGTTAGCTTGGACTCCAAAGAGGCTGAC
TTCTTTGCAAATTATACCGAGGATGAACTTAAAAATAAGGGAGTACCACTCTAAGCGATT
GTTTATGCGAAAAAATTGGCAAAGAAATGGTCCCACAGCGATTCAAATAACGTTTAGCAA
TCTTCAAGTTCACCCGCAAAGAAAGGTAGCGGAGCTATTATTGAAGAAGATTTAAAAGAG
GACGACCAATATACAGATTCTAAATAACATTGA


>Contig22783.0.g18(protein)
MEKQLLRDIKQKHKGFHTINQYSIIKELGQGSYGVVKLVQKNETLEKFAMKMFWKSKLKR
EKEFIKQDDDGQLIVKDALQDVLREIEIMKELDHISLIKLHEVIDDQQDKLYMIMDYAQY
GQVMNWDVEARLFSPCVSDKECFSEKDIQKILRDCIRALDYMHQNGIVHRDIKPQNIMLD
ENGIAKIGDFGCSIQFQNGNDTMQNTIGTYQFFSPECCDPDIKTFSGKANDVWALGITLY
ALIYNELPYWAETEMQVLEEILTKEIQYQDKKRQVSDGLRFILMRMLEKNPKKRVTLKEL
KRNSWLNDGYTVSLDSKEADFFANYTEDELKNKGVPLQAIVYAKKLAKKWSHSDSNNVQQ
SSSSPAKKGSGAIIEEDLKEDDQYTDSKQH