Identifiers and Description

Gene Model Identifier

Contig10733.0.g71

Standard Name

STK2

Aliases

Contig10733_0_g71

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam13499 ) EF-hand domain pair
  • ( pfam00036 ) EF hand
  • ( pfam13202 ) EF hand
  • ( pfam13405 ) EF-hand domain
  • ( pfam13833 ) EF-hand domain pair
  • ( pfam12763 ) Cytoskeletal-regulatory complex EF hand
  • ( pfam10591 ) Secreted protein acidic and rich in cysteine Ca binding region
  • ( pfam06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( pfam04558 ) Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1
  • ( pfam10707 ) PhoP regulatory network protein YrbL
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam07914 ) Protein of unknown function (DUF1679)
  • ( pfam09860 ) Uncharacterized protein conserved in bacteria (DUF2087)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001609301.000295666700457e-168Protein kinase domain containi
ng protein
SGDYFR014C2.0009381340492598e-66CMK1 SGDID:S000001910, Chr VI
from 173877-172537, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10733.0.g71(coding)
ATGGATTCAAGAAACGATTTCAAAATCTAAGCCACCAAGTTCGTCACCCAGAACGCTGGT
AAGCTCAGAGATCACTACAGAATTGGAAAGATGCTCGGCAGTGGCGCTTTCGGAGAAGTG
AGAATGTGTGTTCACAGAGAAACAGGTGCCCAAAGAGCTGTTAAGGTTCTGAGAAAGAGT
CACATGGACGATGATGAGAAGAAAATGCTTTTTAACGAAATCAACATATTGCGTGAATTG
GATCACCCAAATATTGTGAAAATGTACGAGTTCTTTGAAGATGAGAAGAGATATTATATT
GTCACTGAGATCTGTAAAGGAGGTGAATTGTTCGATGAGATCATCGCCAGAGGTAAATTC
ACAGAGAAAGATGCTGCTATCTTGATGAAGCAAGTCCTTTCATGCGTCAACTATTGCCAT
AAAAACAATATTGTACACAGAGATCTTAAGCCAGAAAACATTCTCCTTGAACAAAACAAG
GACTTTGATCAGATTAAAATTATCGATTTCGGAACCTCCCTTGTCTACGACACTGGCAAG
AGTCTCGATGAGAAATTGGGAACTCCCTACTATATCGCCCCAGAGGTCCTCAACAAGAAG
TACAACGAGAAGTGTGATATCTGGTCTTGCGGAGTCATTACATACATCATTCTCTCAGGT
ATGCCACCCTTCAACGGACAAAGCGACTAAGAGATCATGAAGAAAGTTAGAATTGGTAAG
TTCTCTTTCTCAGATCCATGCTGGTCAAACATGTCTGACAAGGCAAAGGACTTCATCACC
AAGCTCTTGACTTACGACGTCGACTCCCGCCCCTCAGCCGAGACCGTCCTCCAACACCCT
TGGATCGTTGACTTCTCAACTCAAGCAGTTGACGCTTCTGTCGCCGTTGGTGCCCTCTCC
AACTTGAAGACTTTCAGAGCTGATCAAAAATTGAAGCAAGCCACCTTTGCTTTCATTGCC
AGTCAGCTTTTATCAAAGAGTGAGAAAGAGAACCTAGCTAAGATCTTCAAAGCTATCGAC
AAGAATGGTGACGGAAAGCTTTCTCTTGAAGAAATCTTGGAAGGTTATGACTTATTCTTC
GGAAAGAATATGGACAAATCAGACATTGAGAAGATGTTCAAGTCAGTCGATATCGATGAA
AGTGGATTTATCGATTATTCTGAGTTCGTTGTAGCAGCAATGAATGAAAAGAACCTCTTG
ACTAACGAGAAGCTCCAGGCTGCATTCAGAATGTTTGACAAGGACGGCAGTGGCTTTATC
TCATCTGAGGAAATCAAGGAAATTCTTGGATTCGGAAAGACTCTTTCAGAAGAAGCAGTA
AACGAAATTATCAGATAGGTAGATGCCAATGGAGATGGCCAGATTTCATTCGAGGAATTC
TCTCAAATGATGAAGAGACTATCCTCATGA


>Contig10733.0.g71(protein)
MDSRNDFKIQATKFVTQNAGKLRDHYRIGKMLGSGAFGEVRMCVHRETGAQRAVKVLRKS
HMDDDEKKMLFNEINILRELDHPNIVKMYEFFEDEKRYYIVTEICKGGELFDEIIARGKF
TEKDAAILMKQVLSCVNYCHKNNIVHRDLKPENILLEQNKDFDQIKIIDFGTSLVYDTGK
SLDEKLGTPYYIAPEVLNKKYNEKCDIWSCGVITYIILSGMPPFNGQSDQEIMKKVRIGK
FSFSDPCWSNMSDKAKDFITKLLTYDVDSRPSAETVLQHPWIVDFSTQAVDASVAVGALS
NLKTFRADQKLKQATFAFIASQLLSKSEKENLAKIFKAIDKNGDGKLSLEEILEGYDLFF
GKNMDKSDIEKMFKSVDIDESGFIDYSEFVVAAMNEKNLLTNEKLQAAFRMFDKDGSGFI
SSEEIKEILGFGKTLSEEAVNEIIRQVDANGDGQISFEEFSQMMKRLSS