Identifiers and Description

Gene Model Identifier

Contig21666.0.g96

Standard Name

STK19

Aliases

Contig21666_0_g96

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006284404.0002634815779907e-110Protein kinase domain containi
ng protein
SGDYAR018C2.9990874792167046e-33KIN3 SGDID:S000000071, Chr I f
rom 171703-170396, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21666.0.g96(coding)
ATGGTAAAGTTATCTGAGAGAGAAAAATAAAATGCACTAAATGAAGTTAGAATTTTGGCT
TCAATTCAGCACCCAAATATCATTGGGTATAAGGAAGCATTCTTCGAGGATTCAACTTCT
TGTTTGTGTATTATTATGGAGTATGCTGATGGGGGAGACTTACTTAAGTAAATTACTTGT
CACAAGAAAAAAAATACGCACTTTACAGAAAAAGAGGCATGGTATATATTCATTCAAATG
GTAAGAGGGTTGAAAGCTTTGCATGATCTCAAGATATGTCATAGAGACATAAAGTGTGCG
AACTTATTTTTAACTAAAGAGGGAATAGTGAAGTTAGGTGACTTAAATGTCTCTAAAGTA
TCAAAGAAAGGTATGATGCATACCCAAACTGGAACTCCTTATTATGCAAGCCCTGAAGTA
TGGAAAGACAAACCATACGATAATAGAAGCGATATATGGTCGTTAGGTTGCGTTCTTTAT
GAAATGCTATCTCTTCAGCCACCGTTTAGAGCACCAAACATGAATGGTTTGTATAATAAA
GTGCTAAGAGGTTTGTACGAGCCAGTTCCATCTAGTTATTATTCCAAAGATTTACAGCAA
ATGGTTAGAAATTGTTTATAAGTTTCTCCTTTAGCAAGACCTAACTGTGATAAAATTTTG
GCCATGCCTGGATTATTGAATCACTTAACTGGAACTTTAGAATTGATCAACGTTTAGATA
GACGTGGAGAATGAAGGTCTTCTTAATACAATCAAAGTTCCAAGAGATTTAGGTTAAATT
ACAGAGAGATTGCCCAAGCCTCAATATCACATTATGAAGAGAACCAACAGTTTACCTCCC
TAAAAGCTTCACACTTAAAATGAAGATGACGAAAATCTAATTCAGCAAGCACATAAAATG
TTTGATCATTAAAGAAAAATACCAGGGGGTCTAGCTCAAAATTTTTACGAAGAGAGAAAA
CAAAGCGTCCTAGCAACAATTGAAGAAGACGTACCAGCATCCAAAGAGTAGGATAGACCT
CACGATTACTATTAAGACATCCAAAGTAATAATCATTTGTTGAATCCTAAGTCAGCCGAA
CCTAATTTGTAAAAAAGCAAAGCAAAAAACCTTCATAATATCGAGAAGTATTCGTTAATT
CATGAAACCAGGACTCCTCATTATTTGGCAAATTAGAAATCTAAAGCAAGAGATCTGATA
TCTCACTAGAGCTAGGAGAATTAAAATGGTTGTCTATTACCTAGAATATAGTCAACAAAG
GCAACTGATATATCTAGTTAGGGAAATGCCTTAAGAAAGATATCAAGTAGACAAAGTCTA
GACACAAAACTAACCAATAATTCTTCAATTTTGCCTCAAATACATGGTATCTAAACTCGT
AACCATAACAATGAAAATTCCAACCCCAACATGAACCCTATATACATGCACAGAGGGGCA
GAACTGAACCAAGGCAACAAGAACTATCTGCAATAAAAGAAAATTTTACAATAAGTTTAC
GGAGCATATCAGATTCCTACTCATAATTAGAGACGCAATTTAAACTAGAGCAATATAGTG
AGTGATGACTTGTTAAGTGAGATTGGATCTCAAATACCGTCATCTGGCGCTCATGGTAGA
GTTAACCCAAGACACATATTTTGA


>Contig21666.0.g96(protein)
MVKLSEREKQNALNEVRILASIQHPNIIGYKEAFFEDSTSCLCIIMEYADGGDLLKQITC
HKKKNTHFTEKEAWYIFIQMVRGLKALHDLKICHRDIKCANLFLTKEGIVKLGDLNVSKV
SKKGMMHTQTGTPYYASPEVWKDKPYDNRSDIWSLGCVLYEMLSLQPPFRAPNMNGLYNK
VLRGLYEPVPSSYYSKDLQQMVRNCLQVSPLARPNCDKILAMPGLLNHLTGTLELINVQI
DVENEGLLNTIKVPRDLGQITERLPKPQYHIMKRTNSLPPQKLHTQNEDDENLIQQAHKM
FDHQRKIPGGLAQNFYEERKQSVLATIEEDVPASKEQDRPHDYYQDIQSNNHLLNPKSAE
PNLQKSKAKNLHNIEKYSLIHETRTPHYLANQKSKARDLISHQSQENQNGCLLPRIQSTK
ATDISSQGNALRKISSRQSLDTKLTNNSSILPQIHGIQTRNHNNENSNPNMNPIYMHRGA
ELNQGNKNYLQQKKILQQVYGAYQIPTHNQRRNLNQSNIVSDDLLSEIGSQIPSSGAHGR
VNPRHIF