Identifiers and Description

Gene Model Identifier

Contig15326.0.g72

Standard Name

STK151

Aliases

Contig15326_0_g72

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001609304.99929489534828e-74Protein kinase domain containi
ng protein
SGDYDL101C8.998739065740874e-48DUN1 SGDID:S000002259, Chr IV
from 281848-280307, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15326.0.g72(coding)
ATGTCCCCAATAAAAAAGAGATAATTTTATGATGAATACGTTCTTGAAGAAAAGATAGGG
AAGGGGCATTTTGCTTTTGTTTACAGAGCGCATAGTATAGTCGATCCAAAACGAAAATAC
GCTGTAAAAATTATTAACAAGGAATAAATAAGCGACAAAAGTTTAAAGAGACTATAGTAA
GAAATCAATAATTTGAAGATTATTGATCATCCAAATATTGTCAAATATTTTGAGACATTC
ATTGATCCCAACTACATTTACTTGCTAATGGAGCTTTGTGAAGGAGGTGAGGTTTTCAGC
AAAATAGTAAATAAACCTATGGATGAAAAGACTGCTGCAAAAATTATGATTTAAGTTTTC
AAAGCAGTCAAATATCTTCACAATATAGGTATAATGCACAGAGATTTGAAACCTGAGAAT
ATCATGTTTGTGAATAAGGATTCAGATGATATCAAAATTATTGATTTTGGATTAAGCAAG
CAAATTTAAAGACAAAATGAAAGACTGGGGACTCCTTACTATGTGGCACCTGAAGTTTTA
AGCCAAATTTATGATGAAAGATGCGATATATGGTCAATGGGTGTGCTACTTTTCATTCTT
CTATGCGGTTATCCCCCATTTAATGGAAGAACTTCAAAAGAGGTTATTAACTCAGTGAAA
AGAGCTTAAGTAAGCTTTAACACAGAGGAGTGGCTATTTGTTACAGACGAGGCAAAGGAT
TTAATTGTTAATTTGTTATAGAAACCGAAAAAGAGACTCAACATAGATTAATGCTTGAAT
CATAAATGGATAATTATGCATGTGAATAAAAACATGCATTAAGAAATGACTTAAAGTACT
TTTGTTGATACTTAGAGTTTAATTGCAATATAAAATACACAAGATGAGGATTTTGAGAGA
AAAGCTGTAAATTCTCTATTGTATCCAGTCTCTTAATTAAGTTTAGTGATTGAATTTAAA
AAGCTTTTAATCAAGGAACTTTCATACAATAAGCTTATACCTTTTATGAATTTATTCAAG
GAAGCAAAAGACCCGATCTTACTTTAGAACAAATCTAAGCTTCTTTCCAGCTCTTGA


>Contig15326.0.g72(protein)
MSPIKKRQFYDEYVLEEKIGKGHFAFVYRAHSIVDPKRKYAVKIINKEQISDKSLKRLQQ
EINNLKIIDHPNIVKYFETFIDPNYIYLLMELCEGGEVFSKIVNKPMDEKTAAKIMIQVF
KAVKYLHNIGIMHRDLKPENIMFVNKDSDDIKIIDFGLSKQIQRQNERLGTPYYVAPEVL
SQIYDERCDIWSMGVLLFILLCGYPPFNGRTSKEVINSVKRAQVSFNTEEWLFVTDEAKD
LIVNLLQKPKKRLNIDQCLNHKWIIMHVNKNMHQEMTQSTFVDTQSLIAIQNTQDEDFER
KAVNSLLYPVSQLSLVIEFKKLLIKELSYNKLIPFMNLFKEAKDPILLQNKSKLLSSS