Identifiers and Description

Gene Model Identifier

Contig12907.0.g37

Standard Name

STK148

Aliases

Contig12907_0_g37

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004120801.9998745702418095e-48Protein kinase domain containi
ng protein
SGDYPL140C2.9998215087698487e-30MKK2 SGDID:S000006061, Chr XVI
from 289034-287514, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12907.0.g37(coding)
ATGCTAGGTTCTGGAGGATTCGGTTAAGTCAGTTTAGTTAAGGAACGGGATACAAAATAT
CAAAGGTATTTAGCTTTAAAGAAAATTAACATTGGAACTACTATGAATGAGCAGAAGAAA
TTAAGAGTTATGAGGGAGACACAAATCTTGTAGTAGTTAAATCATCCATCCATCATAAAA
ATGCATGATTACTTTATCGACTAGGAAAACAGTGCGAAGTAGCTTAATTGCAACTGGTAT
TTATGTATAACTATGGATTACGCAGCTAATGGAGATTTACTCTAGCTTATAGAAAAGTAT
AAAAGTGAAAAACAGCACATTCCAGAGAATAACATATGGATTATAGCGAAAGAAGTGTGC
GAGGGACTCTCTTATTTGCATTCAAGAAATATCATACATAGAGACATTAAACCTTAAAAC
ATTCTTATAACTGGGTCTAATAGCTATAAGATAGCTGATTTGGGAATATCCAGGGAATTA
AGTTCCAAAAATTAATAACTACATACCTCAAAAATTGGAACTCCTTTGTATTAATCGCCT
GAACTGTTAAGAAAGTAGCCATATGATTTTAAAGTCGATATTTGGGCTCTTGGTTGCCTT
TTATACTTCTTAACGAGCCTTGAACATCCATTTCATATCAATAGATAATAAGTATCACCT
TTGAGAAATGAAAATTTTGGAAATGGACTTTCTCACAAGCAATAATTAGAATATCAAATC
TTGAATCATGCCCCAAAATCTATCCCTGAACTATATTCTTATAAACTTCAAATATTAATA
TAAAGAATGCTTGATAAGAACTAAAACACACGTCCAAACGCTATTGAAGTCTTAAAATTA
ATCCCTACTCTTGAGTAATAGTAAACACCATTTTCTTAGATTAAGTTCGAATCTTAAAAT
AATGTTATTAAGACACCATAACCCTCAACTAAACAGCTAATTAGTAATTAGTAGAAATTG
AAAAATACCTAGATATTTGGAAAAGATTTGAAAGCTTAAAAAGTCGTTTCAACTGAATTC
GAATAAAAATCTTAACTTGACAATAATATAGAAAAAGAACCGGACAAGACATCATATAAC
CAATCTGATGCTGATAAAATTAACAGCTAGATGCAATAGTCTACTAAAGATACAGAAAAC
GATACTTTAAATATTCTGAGTAGTGCCAATTTAAAAGCATCTCATGGAGGAGTAAAGCTA
TTCAATAGAACTATGTATGACAAGTCTCTCTTCCAACAAAAACTTAACTAGAAAGTAAAA
GTAGAAAAATTTGAAATTAATATATCATCGTAAACCAATATCGAAGATCAAACAACAAAG
AAAACACTTTCAGTCTCAATCAGAAATAAAAATTAAGTTAGTTGTTCTAATCCGCAGGGA
AGATAACTCATGATAAATCTTACCCATAATCACTATTTTATCAGACTAATGGCAAGAGTA
GACATAACCCACACCAACTCCCAATCAAAAATTAGTTAAACTTACCAAATTAATAAATTT
AACAAAACACATTGGTTAGGAGTTGGCTGGTAGAGTAAAGACAAGACAGAGATTAAGAAT
ATGGATGTGCTAGCAATTTATTGCAGAGTTAAGTTAACCAAGTTCAAATATCTCCATTTA
ATCAGACAAGCATAGGTTCTTTTCAACAAAACCTTAAAATTTAGTTAAATAGTGTGA


>Contig12907.0.g37(protein)
MLGSGGFGQVSLVKERDTKYQRYLALKKINIGTTMNEQKKLRVMRETQILQQLNHPSIIK
MHDYFIDQENSAKQLNCNWYLCITMDYAANGDLLQLIEKYKSEKQHIPENNIWIIAKEVC
EGLSYLHSRNIIHRDIKPQNILITGSNSYKIADLGISRELSSKNQQLHTSKIGTPLYQSP
ELLRKQPYDFKVDIWALGCLLYFLTSLEHPFHINRQQVSPLRNENFGNGLSHKQQLEYQI
LNHAPKSIPELYSYKLQILIQRMLDKNQNTRPNAIEVLKLIPTLEQQQTPFSQIKFESQN
NVIKTPQPSTKQLISNQQKLKNTQIFGKDLKAQKVVSTEFEQKSQLDNNIEKEPDKTSYN
QSDADKINSQMQQSTKDTENDTLNILSSANLKASHGGVKLFNRTMYDKSLFQQKLNQKVK
VEKFEINISSQTNIEDQTTKKTLSVSIRNKNQVSCSNPQGRQLMINLTHNHYFIRLMARV
DITHTNSQSKISQTYQINKFNKTHWLGVGWQSKDKTEIKNMDVLAIYCRVKLTKFKYLHL
IRQAQVLFNKTLKFSQIV