Identifiers and Description

Gene Model Identifier

Contig20102.0.g97

Standard Name

STK140

Aliases

Contig20102_0_g97

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011426701.9991716194688635e-85Protein kinase domain containi
ng protein
SGDYAR019C5.0007856079333316e-54CDC15 SGDID:S000000072, Chr I
from 175135-172211, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20102.0.g97(coding)
ATGTGGGAGCTCATCGGAAAGGGGGCTTGTGGAAAAGTATATAAAGGTTTAAATTTATAA
AATGGGCAGCTTGTGGCAATAAAGCAAATTAGGATCAATAATTTCAAGGAGCATAACAAA
CGATCATTACAAAGCGAGATTAATTTACTGAAGAAGCTAGAACATCCTAACATAGTCAAA
TATATAGATTCAATACAAACTGAGCAATATCTAAACATCATACTGGAATATGTTGAAAAT
GGCTCTCTCGATAAACTTGCTTAGAAATTTGAAAAGCTTCCTGAAACACTGGTTGCAATA
TATGTCTATTAAGTTTTACATGGACTGGATTACCTTCACAGATAGGCAGTTATTCATAGA
GACATAAAAGGCGCTAATATATTAACTACAAAAGATGGTATTGTAAAGCTTGCTGACTTT
GGAGTAGCAACTAAAATCAATGAGTCTGAAAAAAGTAACTCAGCAGTGGGTACTCCCTAT
TGGATGGCACCAGAAGTTATAGAGATGAATGGATTAGTGACTCAAGCATGTGACATCTGG
AGTTTAGGCTGTACAGTTATTGAGCTCATGACAGGTTAGGCACCTTACTAGAACTTTCAG
CCGGTAACTGCTATGATAAAAATAGTTTAGGAGGGAATTCCTGCTCTGCCAGAATCCTTC
TCAGAAGAGTTGAAAGACTTCCTTAGCAAGTGCTTTGAGAAGGATCCAGACAGGAGGCAC
AATGCGCAAAGTTTGTTACAGCATGCTTGGATGAAGAAATACGATACTAAAATGTTCTAA
AATATTATCAATAGCAATTAAGAGCTACCTGAACTTGTTTCAAAGACTATAAGAACTCAT
ATTAGTTAAGCAGGAAAGCCATATAATTCAATGTATCAAAAGGTAAAGGATAATAGAGAA
AATTAATTAGATAACTTAAATTAAATAAGCATAAAATAGCCAATTCAATAGTAGCACAGA
TAAAATCTAATAAACAGTGTAAGCATGTAGCAGGAATGTCTAGTATAAAAGAAGCCAACT
TAAAAAGCAGAGGACGATGAAGATGGAGAGTTAGGGGATTTCGGGGAAGAGATCAATGAC
ATGAACGATGTACCAATCGAAAGACCAAAATGCCTATCAAACATAAATTTCTCTAGTAAC
CCAAATGACAAAAATGAGTAGCTCTAAATGATGATTAAAGATCAAAATATGATGCAGCCA
CCAATCAGTAAAGTTCGAAGATTGCAAACCAATAGGAGCATATAAAATTCTAGATCAGGG
TATATCAATAACAATTAAGCAGTAAACCCAATTTAGTAAATACAAAGCATCGAATAAGTC
TAACAAGAAATAAACTTCTCAGACGTTTCTTAATAAAAGCAATTTCAACAAATTAATTTG
AAGCAACCAAGCTTAAATTCACAAGCATCAATTAATCATATCACTAATCTCACTAATTAG
ACATCAATTTCCTCCTAAAATACAGTTCAAACTGCTGTAAATTAAAGGGCAGGATCAGGG
AGCTAGAGACAAATGTACAAATCTTAAGATAAGTCTGCTGGCCCAGGGTCAGGAAATGCT
ATGCAACATCCTAAATAAAGTTATTCACAGACTCCTTAAAATATTGCCTAGATCGATCTC
CAAAATTAGTCACAATAAAATCAAGTCTTTGATGTATAAGGGAATAGGAAAGTCTATTAC
TTAACTAAGAAATCTAAGTAAGGATAAACCCAGTAATATGAAATTTCTCATGCTTATGCA
GGATCTGGAGGAGTCTCAGGGACGAACAATCCAAACGAAATATCTCAGATGTCTTTGTCA
CTTAGTTAAACTTCAAGGCAAAAACGAATTGAAAAATAATAAAGATAAGGCGTGATAAAT
CTACATCAGCATCACATGACAGCAGCAAATGCTAACTATCAGAATAATCAAGTCAACTAA
GGAAACTTTAATTTCTAATTTCAGCATGACAGTTAGGATTATGAGCTTTAAAACCCATAA
TTCATTGGGAGATAATAAAGTGCTCAACAACCACAGACTTAGTAGATTATAAGAAACATT
CAGCACTAGCATAACTACACTTAAATGCCTGTAATGCCTTAAAATTAAATGCTTTATCAG
TATTCAGATACCGAAATAGCTCCTAATAACGATCCGAGGTTTATGAGTGACAATATGGCA
GGGATATAAGCACATCAAAAACGAAAGTATACTAATCAATTTGATAAATAAGGAAATATT
CTTCAGAGTAAATACAATTCAGGTTCAAACTAGAGTTACATCAATGATCCTAGTATGTAA
AATAAAATGGTTATGTAAGAGGGCTTCGATGAATTAAAAAGTGATAATTTAGATGAAGTA
TACATTCAAAAATAAGAGTCTGATTTTTCAGGTCCAAACTTTCCTAAGTAATATATGTTT
GGTTCCTCTGCTGACTTCAATATGCAAAATGGTTAATCTCTAAGAAAAAGGACATAGCTT
TCAGAATAAAAACTTGGCCGAGGTCATCTTACTCAGTTATATGGAAATTCAAATAACAAC
TAGATGTTTCACCACATTCAACATAAATCAGTAATCAGTGGATTTTAAGGTTCAAGTGTT
TCTCCAAGTAACATGGCAGGCTTATCTCAGTAGTAATTCATGTAGGCTGCTCAAAGAAGG
AACGGTACTAAATAAGATGGAACAAATGGGAGCTTCGAAAATTTCCTCGATACAGTCTCT
AACTATGAAGACTAATATTTATTCGGCACTGTAGGAGGGACCTCAATTCCTACTAATATG
AGAGCTTCAATGATAAACATGTAAAATCTCAAAAATGTGAGAGAAAGCTATAGCAAAAAG
TTTGCAGACCAAGTCAGAACAAATCAAGAAGATTAAAGAGTTGGTATGATGATGATGTAC
GCAATGAACCCATAAATGCAAAATTATTCTTCAGAAGCGGATTCAAATACTAGATCAAAA
ACTATAACTCAAACTTAAAACATCAATTAACTAGCAAAGCAAAATACCAATTAATCATCA
ATTTAAATGTAAAGTATTGGGTCTGGGAGAAGTAATAACTCAGTCCAAATTCATTAGCAA
GTTGACACAGAGGCAATGGAGCAACTTCAAGAGGAGTGCAAGTAACTCTCTAAAATGATA
AGAAAAGCATATGAAGAAATTACATCATAATAGAATGATTCATTTTAAGAGATTACAGAA
CCAAATTTCGTAACTTAAACAGAAATGACAGAGGAAAATTAAGAAACAGACATTAACGAA
TAAAAACTCTAAAAAGAATAAGAACTGAAACAACTCATATCACAACTTTCTGATTTTTTA
AAGCAAATAACTTCTCAAAAACAGAAGGCAGCAATTGCTGATTCTCTCGGATACCACAAT
ATGTTGGGACTTTTAAATCTCTCTGATGAAATCATATACCCGACTCTTCTTTTGATAAAT
CAATTTAGTGAAGGCTCTAAGAAAGTTCAAGATAATCTTTGTATTTGCGGCTTCTTACAA
AAACTTATCTAGCTTAGCAATCCTTTAAACAAGAGGGAAATAATTCTAGATATTGGCTAC
TTTATAGGTCAAATCTTCCAAAGTTAAAGCACTGCATTTATTCTATTTGTGAGTGGTGGT
GGATGTTAAATTTTAACCGATTTCTTGGATTTTCCATATGAAGAGAGCAAAGACATGATT
ATGTTGGCAATTGATGCTTACTATGTATTGTCAAATGAAAAAATAGATCTTCTTCATCTT
CCAACAGAAGACATTACCATATTTCTATCTAAGTTTCAGATTGTAGAAAAGATTTCTTCA
ATTATTCCTAAGATTTACAATGATATCGAAACATCAGAAGCCCTTATTTAGTAAGAACAA
ATGTTGAATTATCTTGAAAAAGCCTTCGATATTCTCTAAAAAATTATGGATGGTCCATTA
GAAGTAGTTAAGAGAATTTCAATGAATTAATCACTTAAAAATGGTTTGTGCAAAATAGTT
TAAAATACAATAAATGACCCAAGTCATTATACTGTAATGATTCTTAAAAGATTTTTGAGG
ATATTACAGCTTGCTACTCAGCATCAGCAGATTTTTAGTTCATTGGAGAAGTAAGATGTA
GTGAGGGTTTTGGTTGAGATACTTCAATTCTTCTTAAATGATATTGATCATGTGCAACTT
TAATTACCCTATGACAACCTGAAATTATTAAACTTACTCTGCAAGATTTCTACTTCAAGA
ACTGAGCAAGCTTCAAATGCCTCTTTAATGGAGCATGTCTTTGATTTAATTGAGTACCTT
AAAAGTAAATAAGACTCAATCAATACCTTTGTACTTTGGCTTTAAACTGATACTTCTCAA
ATTGAATAGTTCCTTAGCAAGAGAGAAACCTTAGATACAATTTTCATGTTGTATTTCTAA
AATCCAAAGAGCAAAATAATGCTACAAGTATTCAGTTCAATAAACAGAATGGTTTAAGCT
AGCCCAAAAATAGTGGATGCTTTAGCAGCAAACTCATTAATCATTGAATAACTACTCAAC
CAAGTTATAACCTGTGAAAAATAAATTGTCTCAAGTGCAAGAAGTATCAATGAACTCGGA
AGTCTGGGCTCAGGCCAATAATTAGATGAAAATACACAAATTGCAGTCAATAAGAATTAT
TACGATTAAAGAATTCAATTTAATTTTACTTATCAATCTTAGCAATATGAGGAGGTAGTT
ATGAATAGACAAATAAGACAAGGTTTATAAATGGATCCACAGTCAATGTAGTTAGTTTAA
AATTTACAAAGAATTAATAATGATGGGGTAAATTCAACAAGAGCAAAAAGTCCTCTTTTC
CAGTGA


>Contig20102.0.g97(protein)
MWELIGKGACGKVYKGLNLQNGQLVAIKQIRINNFKEHNKRSLQSEINLLKKLEHPNIVK
YIDSIQTEQYLNIILEYVENGSLDKLAQKFEKLPETLVAIYVYQVLHGLDYLHRQAVIHR
DIKGANILTTKDGIVKLADFGVATKINESEKSNSAVGTPYWMAPEVIEMNGLVTQACDIW
SLGCTVIELMTGQAPYQNFQPVTAMIKIVQEGIPALPESFSEELKDFLSKCFEKDPDRRH
NAQSLLQHAWMKKYDTKMFQNIINSNQELPELVSKTIRTHISQAGKPYNSMYQKVKDNRE
NQLDNLNQISIKQPIQQQHRQNLINSVSMQQECLVQKKPTQKAEDDEDGELGDFGEEIND
MNDVPIERPKCLSNINFSSNPNDKNEQLQMMIKDQNMMQPPISKVRRLQTNRSIQNSRSG
YINNNQAVNPIQQIQSIEQVQQEINFSDVSQQKQFQQINLKQPSLNSQASINHITNLTNQ
TSISSQNTVQTAVNQRAGSGSQRQMYKSQDKSAGPGSGNAMQHPKQSYSQTPQNIAQIDL
QNQSQQNQVFDVQGNRKVYYLTKKSKQGQTQQYEISHAYAGSGGVSGTNNPNEISQMSLS
LSQTSRQKRIEKQQRQGVINLHQHHMTAANANYQNNQVNQGNFNFQFQHDSQDYELQNPQ
FIGRQQSAQQPQTQQIIRNIQHQHNYTQMPVMPQNQMLYQYSDTEIAPNNDPRFMSDNMA
GIQAHQKRKYTNQFDKQGNILQSKYNSGSNQSYINDPSMQNKMVMQEGFDELKSDNLDEV
YIQKQESDFSGPNFPKQYMFGSSADFNMQNGQSLRKRTQLSEQKLGRGHLTQLYGNSNNN
QMFHHIQHKSVISGFQGSSVSPSNMAGLSQQQFMQAAQRRNGTKQDGTNGSFENFLDTVS
NYEDQYLFGTVGGTSIPTNMRASMINMQNLKNVRESYSKKFADQVRTNQEDQRVGMMMMY
AMNPQMQNYSSEADSNTRSKTITQTQNINQLAKQNTNQSSIQMQSIGSGRSNNSVQIHQQ
VDTEAMEQLQEECKQLSKMIRKAYEEITSQQNDSFQEITEPNFVTQTEMTEENQETDINE
QKLQKEQELKQLISQLSDFLKQITSQKQKAAIADSLGYHNMLGLLNLSDEIIYPTLLLIN
QFSEGSKKVQDNLCICGFLQKLIQLSNPLNKREIILDIGYFIGQIFQSQSTAFILFVSGG
GCQILTDFLDFPYEESKDMIMLAIDAYYVLSNEKIDLLHLPTEDITIFLSKFQIVEKISS
IIPKIYNDIETSEALIQQEQMLNYLEKAFDILQKIMDGPLEVVKRISMNQSLKNGLCKIV
QNTINDPSHYTVMILKRFLRILQLATQHQQIFSSLEKQDVVRVLVEILQFFLNDIDHVQL
QLPYDNLKLLNLLCKISTSRTEQASNASLMEHVFDLIEYLKSKQDSINTFVLWLQTDTSQ
IEQFLSKRETLDTIFMLYFQNPKSKIMLQVFSSINRMVQASPKIVDALAANSLIIEQLLN
QVITCEKQIVSSARSINELGSLGSGQQLDENTQIAVNKNYYDQRIQFNFTYQSQQYEEVV
MNRQIRQGLQMDPQSMQLVQNLQRINNDGVNSTRAKSPLFQ