Identifiers and Description

Gene Model Identifier

Contig1732.0.g31

Standard Name

STK135

Aliases

Contig1732_0_g31

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000777209.000751454575209e-33Protein kinase domain containi
ng protein
SGDYOL100W7.001594317853847e-31PKH2 SGDID:S000005460, Chr XV
from 129237-132482, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1732.0.g31(coding)
ATGAAAAGTTTATTTGACAACCCACATAATAAAATTAATGCATAATTTACCTTCAAAAAA
GTCACCTAGCAATTAGTCGAAAAGATAACAATTTAATACTTCAAAATTTAAAAATCCATA
GGAACCTACATTATCAATGACTATTCCATTCAAGATTAATAATCCGTACAATATGATTGC
GGGTTCTTCGAAAAATATATAATATTATTTGAAAAGGTGAAGCTCGATAAGATATAAGAT
TGTGAGATAGCGAACAATTAGATCTCATAACATGAGTTTGACAAAGAAAATACTATGACT
TGTAATAAAAATTAGATTATAGCAGGCGATTTCTTCATCCCAGTATATTATTTAAATCTT
CAAAATGCTCATTATCAAGTACTAAAGCAATCTAATTCTCTTGGGATTTTACCCAAAATA
TTGGGATATACAGATAATAAAAGATCAGCAAGTAAATTTATATTCAATAAAAATGGCAAT
ACAATAGTATTATAACACGATAATAACAACTCTCCAAATAAAAATCCTTGCGACTCTGAT
TAAAGTTTCTTATCTAATTTATCCTTAAAAGCACTAAAAAAGACATAGAAAAAATATTGC
ATAAAATAATTTACCTAGAAAAAGTTTTTATTCTCGTCAAAGATAGGACAAGGATTCACA
TCTGATGTCTATAAAGTTTAAAAAATATCAGATGCCTCAAAGACTTATGCTTTAAAAGTT
ATTAACAAGGATAAGCTAGACCCTATAATTAAGAAGCAAATAGTTGATGAAATCAAAATC
TTAAGAAAGCTAAGTAGCTGCACTTAAATTAGTAAAATCTATAGAGTGTATGAGAATCAT
TCAAATGTGTACTTGCTTTTAGATTATATTCCTGACGGAGACTTAAAATAACTAATACAC
GGTACTAACCTTAAACGATTAACCCCATTTCCAGAGTCAGAAATAAGAATGATATTGGCA
TAATTATTGCTATCCATTGATTTCATGCACAAAAATAATATTATTCACAGGGATATAAAG
CCAGAAAATATTCTTGTGACTAGAAATAGCAAATAATCAAAGAGTAATATATTTAATAGT
GCAAGTAATGCCAAATAATTTGTGTACAGATAAGAAATCTTATAGGACTCTAATTCCATA
ATATAAGTCACTTTAGCAGACTTTGGATTTGCTGTAGATTTAAATTAAAATACAAACGAT
GAAGCTTATGACGAAGACACCGTGTGTGGCACCCCTGGCTATTTTTCTCCTGAAGTTTTA
TAAGGATCAAAATTAGACACAAAGTCTGATATTTTTAGTTTGGGTTGCCTAATATACAAG
TTTGTAACAGGCGAAACTTTGTTTGAGGGTGGTACTATTAAGGACTTGCTAATTAATAAT
AGAAAATGTAATTTTGCTAAAAATATGAATAATAAGCTGAGTAACTTTTCTCCTTAACTT
TAAATTTTAATAAGAGGCTTGCTCACTAAAGACCCTAAAGAGAGACCTACAGCTGAATAA
GCCCTCTAATATCCATTTTTCAATCAAATATCAAGAGGCCTATTTCAATGTCTTGCCTTA
AATTAATTGCATTCCTAAATAAGCATGAAGAATACAAAATAATCTAATCAAAATTAAAAA
TATCCATAAATTAGCAATTCACAATTTTATCAAAATGTTCAGCAACATACTAAATAAAAT
AGAAGAATAAACAAGAAAATTAACTATTTAAGAATTTTAAGGGACTCAGTGATGTTTGAG
ACTGTTCATTAATAATCATTATATTAAAATAAAAAAGATTAGAGTAGAATTTAAAAATAC
TAATAAAATCAAGGAAAATTGTCATAATTTGCTTCTCGTCACTATTAATAATAAAATTGC
GCTATTGAAGATGATTAATATATACCAGAGTCAAATGAGCTAATAAAATAGAGATTGCTT
AATCCTGAATATTCACCTTTAAAAAATGAAGGATTTAGAAAATATTCAGTTATCACAGAA
CAAAGACAAAATTTGAATTCTCCTCACTTAAATATTAAATAAAATCCCTTAACTCCTTCT
GCTTCCCCAGATAAACATCTAAGAGTCGATTAGTGCACTAATTCAAGAAAGATAGCGAGG
AAATCTCGATGCATTAGAATATCCTTATAAAAATTCATTCAAGAAAATAGTGAATATTTA
AAAAAGGACCTTTAATAAAGAAATGAGGGAAAGGAAATCAATATAATTTACTCTGATTTT
AGAAAAAAAGATTTCAATTTATCTGAAATAGATGATTAAGTAGGTATCAATGTATTTGAA
GTTCAAAGACAACCTTATACAAAATATAAATGCAATATTGATTGCAATCAAAAGCAAGAT
TAAAATGTTCATAACATGAATAAATCATCATTTGACTAAAATGGTAATGATGAGGAGATC
TTATTTTCTTCCACAGAACTAACAATGAATTAAATCTAGAGCGATAGATTATTCTGTACA
GACCCAAAATCAGGAATGGCACAAAGAAATATAGTAACTAAAGCAAGAGTGTTCTTGGAC
TATAATTCTTAAATATGA


>Contig1732.0.g31(protein)
MKSLFDNPHNKINAQFTFKKVTQQLVEKITIQYFKIQKSIGTYIINDYSIQDQQSVQYDC
GFFEKYIILFEKVKLDKIQDCEIANNQISQHEFDKENTMTCNKNQIIAGDFFIPVYYLNL
QNAHYQVLKQSNSLGILPKILGYTDNKRSASKFIFNKNGNTIVLQHDNNNSPNKNPCDSD
QSFLSNLSLKALKKTQKKYCIKQFTQKKFLFSSKIGQGFTSDVYKVQKISDASKTYALKV
INKDKLDPIIKKQIVDEIKILRKLSSCTQISKIYRVYENHSNVYLLLDYIPDGDLKQLIH
GTNLKRLTPFPESEIRMILAQLLLSIDFMHKNNIIHRDIKPENILVTRNSKQSKSNIFNS
ASNAKQFVYRQEILQDSNSIIQVTLADFGFAVDLNQNTNDEAYDEDTVCGTPGYFSPEVL
QGSKLDTKSDIFSLGCLIYKFVTGETLFEGGTIKDLLINNRKCNFAKNMNNKLSNFSPQL
QILIRGLLTKDPKERPTAEQALQYPFFNQISRGLFQCLALNQLHSQISMKNTKQSNQNQK
YPQISNSQFYQNVQQHTKQNRRINKKINYLRILRDSVMFETVHQQSLYQNKKDQSRIQKY
QQNQGKLSQFASRHYQQQNCAIEDDQYIPESNELIKQRLLNPEYSPLKNEGFRKYSVITE
QRQNLNSPHLNIKQNPLTPSASPDKHLRVDQCTNSRKIARKSRCIRISLQKFIQENSEYL
KKDLQQRNEGKEINIIYSDFRKKDFNLSEIDDQVGINVFEVQRQPYTKYKCNIDCNQKQD
QNVHNMNKSSFDQNGNDEEILFSSTELTMNQIQSDRLFCTDPKSGMAQRNIVTKARVFLD
YNSQI