Identifiers and Description

Gene Model Identifier

Contig11669.0.g105

Standard Name

STK129

Aliases

Contig11669_0_g105

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000463306.000161128365848e-68Protein kinase domain containi
ng protein
SGDYMR001C2.9998215087698487e-30CDC5 SGDID:S000004603, Chr XII
I from 271136-269019, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11669.0.g105(coding)
ATGGATAAATACGATAAAGTTAGAAAAATAGGCAGAGGCACTTTCGGAGATGTACTTTTA
GTACAGAGAAAAGATAATCAAGAATTTTTCGCTATGAAAAGAGTGCCAATTGAGCTTGAA
GAGAAGGAGACTAAAGAAATTAACAACGAGGTATGTGAACATAAAATTTCATTGGACTAT
TCAAACATTCTTAAAAATTAGATAGCTGTTCTGAAAACTCTCAATCATCCAAACGTTGTC
AAATATTATGAATCATTTACATACAATGGAAAATTATGTATTGTAATGGATTATGCTGAA
AATGGCGATCTTCAAAAGAAGATAAAAGAAGCTAAGGCATAATCATAGCTTTTTTAAAGA
ACTTAAGTAAGATTCGATAAATATTTTGAGTTTAAAGTATAGATCATGTCTTGGTTCTGC
CAAATATGTTTAGCTTTGAAGCATATACATGCCAGAAAGATTTTGCATCGTGATTTGAAG
AGTTAAAATATCTTTATAACAAAAGCGAATCATATCAAAATAGGAGACTTTGGCATCTCT
AAAGTACTTGAAAACACTACAGATTTCGCTAAGACATCCCTTGGTACTCCTTTTTATCTA
TCGCCTGAAATTTGTATGGGGTAAAAATATGATTACAAATCTGATACTTGGATGCTTGGA
TGTGTTCTTTATGAATTGTGCACTTTGAGAAGGCCTTTTGAGGGAGAATCATTGAACGTA
GTAATCAATAAGATTATTTATAAGCCATACATAGAGTTGAGTAAAGAATACGAGCCAATA
TTCCATCAATTGCTTGATATGTTACTGCAAAAAAATACTTACTTGAGAGCATCTATTGAT
GAAGTTTTGAGTTTGCCTTAAATTTAACAATAAGTCTTCAATATTCAATAATAAAATCCT
GATCTGTATATCGATGAGGTGAAAAAACAACTTAAGCTCGAATTAAATAGTACTCTAAAC
ACTTAAATTTGGCAATAAAATGATTCTTCACCTAACAAAGAATGTAGTTTTACATTTGTA
GGTGGATTGATAGAATCAAACAGAATTGAAAATCAAGTAAAGACCGAATAGGATTATAAT
ATAGATGAAGTTGATCTGTTATTTGATCAGCAATAAAAGCATACACTGTAAAGATTAATG
AGTCCATAGAAGCAGCCTTAAACTTACAGACTCGATAAATATACTCATTAATAGAATAAG
TCAGTTATAGGAAGGCCCTCAAGGTAACTTACTGCTGGCAGCGATGATAATTTGTCGACT
TATGTGTAGACTTAAAAATCTTGTCAAAAAAGAGAAGAGCCAAAGACTCCAGACATCAAT
AGAAACAGTGGAGGCACTACTAATCCAGCAAAAATTAAGTAAAACAGCATATATTACTTG
ATTTAGCAAGCTAAAAAGATTAACTCCCCAACAACAATAGAAGATCCCTTAATAGTAGGG
AATGACGATATATTGAAAACTCAGAGTGACTTGTCTCCATTGCCATTTAGCAGAGAAAAT
TCTAAGACTATAAAATTGAAGGAAAATGTTGAAGATGCTGACGAGGAGCTTGGAGATGAA
GATAATGAACGTAAGGGGAGACTAGATATTGTTCCATCAGTATTTTCTAATAGTAGAAAC
CTTCATGAAAAAGGAATGCACAGCTTAAAACAGGTAGTGAACATTTAGAAGCAGCAATAG
TAAAGTCTCTTAGATCTGTAGTATTCACAGTAAAACATGACAATGGATAATTCAACGAAA
AATTCATAAAGTAAGGCTCTATAACTCAGAACTTAAACTGCTTAAGGCAATTATCCTGAT
AATACTAAAAATATGAATAATTAGCAAGTGGATTCTTTGGGTAAAGACCCTTAATCAAAT
TAAAGTTCAAATAATTTAAATGAAGATTAGTAACTACATAGTTATTAAGTCCAATCAGAT
TAGATTCGTAATTCTGAGAATAAATCTTAAACAAGGGGCTATGTAAAGAATTTGAAATAG
TTCTCAAACAGGCAATATGCTATATAAAACTAAGAATAATCTATTCCCTATCAATAGCAA
ACTTCATCTTAGCAAAATCAATAAATCCCTTTGACTCACATCTCTCATCATCCACATCCC
TCGTACCATGGCCCTTCTTTCTCATAGAACTAGGAGATGGAATAGTAAGCACTAAGAAGA
CCAATGGAAATAAATACAAATCTAGAGCCTTCAAACAACAAGTTCCTAATCGCTAAAAAG
CAACAGCAGCTTCTCTTATATAAAAAGCGATCCTACAATGATAGATCTGCTAAAAACAGT
TACTCTTTCTGTTAAACAACTTCGTCAAATGAGACTAGTGGGGCTTTTGGGGACTAGTAA
ACTGAGAGTATAAATGTGGTGAGTCACCATTAAATGCCCAATAGTACTGGGGGATCTTTC
ATACATAATGCTAATAGTTATATGAATGCTGTTAGTCCCTTTAACAATGTCGCTAACAAA
AAGCAAGCTAAAACTCCACAGGACTAAGTCACTGGAAACATAGGAACATAAAACAAAGGC
AAGCATTTCTTGTTTTCTGAAAATTTGCTATTCAATCCTGAACTTCCTGTCTCCCCAAAC
AGACCAATACTTTTCTCAAACTTTCTCAAGTAAAAAATAGGCGAAGAGAAGTTTGACTAA
GTACTCAAAATCTTAGAAAATTCAGAGAATCCTATTAAGCTGTTAGATGAGGATTTTCAA
TAAGTGCTGGATATTATTGGGGAAACAAATGTGGACTGTCTCAAGGTGTTTAAGTACATA
GTGAGCAGTTGCAACTCCACTCCAAACAATGCAGGTCAATCAACCTCTTCAACTTCCAAT
AAGTAATTTCATTTGACGCCCTCAACTCAGTACTCAAACAATTTGGCTGATTCGGTGATT
AATTACCAAAATTCTATCGAAAAAAATCCACAGCTTCACCAATAGTTATCCTCTTAATCT
CATGAAGCCTACTAATAAACATAGCTGCATCAGAAGCAGTAATCCATCGCATATTCAAAT
CGGAGTTCTGATAACATGTAATCCAATGTTTTTTCTTCAAATAACATTGCCTCAACTCTT
CAGAGTACAATGAACAAGAGCAATGGTTTTTCTTAGAAAACGAGTAATCCCATAAATTTC
TATGGGCAGTAAGCAGCCAATATGAATAGTTAGAACTTATAGAAATAAGTTTCTTAATAG
GCTGCTAGTTAGAATTCTATGAATTAAATAAGCCCCTCTCTCATGATGAATCCACACTAT
ATCAAGCAAAGTTCTTTAAAATCAGAGCAGCAACAGAAATAAATGCTATAGCAGCAATAT
ATACAGCAGCAACAGCAATAATAGTAAATGCAGTTCAAACAATCTCAAATGCAATAAATG
TATCAACAATAGCAGCAGTAATAGCATTGGAGAACTAAAAGCATGTAAACACCTCAGGAT
GGTAATCACAATTTTCATAGTAAAATTGATTAAAATGGAGCTACCAACAATATCAGTCCA
AATAATGTATCCCACCACATTTACTAGTAATCAGTGCAAATCAATAACAAACCAATAAAT
TCATAGAATTAATAAATGCAATTTAATCAATAAAATAACTTCACTAATTCCTAATAGGAA
TTCAACTATTATCAGTGA


>Contig11669.0.g105(protein)
MDKYDKVRKIGRGTFGDVLLVQRKDNQEFFAMKRVPIELEEKETKEINNEVCEHKISLDY
SNILKNQIAVLKTLNHPNVVKYYESFTYNGKLCIVMDYAENGDLQKKIKEAKAQSQLFQR
TQVRFDKYFEFKVQIMSWFCQICLALKHIHARKILHRDLKSQNIFITKANHIKIGDFGIS
KVLENTTDFAKTSLGTPFYLSPEICMGQKYDYKSDTWMLGCVLYELCTLRRPFEGESLNV
VINKIIYKPYIELSKEYEPIFHQLLDMLLQKNTYLRASIDEVLSLPQIQQQVFNIQQQNP
DLYIDEVKKQLKLELNSTLNTQIWQQNDSSPNKECSFTFVGGLIESNRIENQVKTEQDYN
IDEVDLLFDQQQKHTLQRLMSPQKQPQTYRLDKYTHQQNKSVIGRPSRQLTAGSDDNLST
YVQTQKSCQKREEPKTPDINRNSGGTTNPAKIKQNSIYYLIQQAKKINSPTTIEDPLIVG
NDDILKTQSDLSPLPFSRENSKTIKLKENVEDADEELGDEDNERKGRLDIVPSVFSNSRN
LHEKGMHSLKQVVNIQKQQQQSLLDLQYSQQNMTMDNSTKNSQSKALQLRTQTAQGNYPD
NTKNMNNQQVDSLGKDPQSNQSSNNLNEDQQLHSYQVQSDQIRNSENKSQTRGYVKNLKQ
FSNRQYAIQNQEQSIPYQQQTSSQQNQQIPLTHISHHPHPSYHGPSFSQNQEMEQQALRR
PMEINTNLEPSNNKFLIAKKQQQLLLYKKRSYNDRSAKNSYSFCQTTSSNETSGAFGDQQ
TESINVVSHHQMPNSTGGSFIHNANSYMNAVSPFNNVANKKQAKTPQDQVTGNIGTQNKG
KHFLFSENLLFNPELPVSPNRPILFSNFLKQKIGEEKFDQVLKILENSENPIKLLDEDFQ
QVLDIIGETNVDCLKVFKYIVSSCNSTPNNAGQSTSSTSNKQFHLTPSTQYSNNLADSVI
NYQNSIEKNPQLHQQLSSQSHEAYQQTQLHQKQQSIAYSNRSSDNMQSNVFSSNNIASTL
QSTMNKSNGFSQKTSNPINFYGQQAANMNSQNLQKQVSQQAASQNSMNQISPSLMMNPHY
IKQSSLKSEQQQKQMLQQQYIQQQQQQQQMQFKQSQMQQMYQQQQQQQHWRTKSMQTPQD
GNHNFHSKIDQNGATNNISPNNVSHHIYQQSVQINNKPINSQNQQMQFNQQNNFTNSQQE
FNYYQ