Identifiers and Description

Gene Model Identifier

Contig18581.0.g102

Standard Name

STK123

Aliases

Contig18581_0_g102

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005791808.996816452944345e-116hypothetical protein
SGDYDR477W4.000437458487249e-40SNF1 SGDID:S000002885, Chr IV
from 1412373-1414274, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18581.0.g102(coding)
ATGAAAGCACCACTCAGCAGGACTACTCTGACAACACTTCAGATAGCTAGTCAAATGAGT
CTTCATATGCATCATCAAGGAGAAGTCAAGTTAAGAATAAAAGCTCATTGGCCAAAAGAG
AGGGCAGGAGAGGTACAATTACATTATTCTCATATTTAATTATGTTTAGGTGGGAATATA
GCAGTGAATTTACAGGTGTTTGATCCCAATTCAAGAGTCATTATATAAACTGATGGGAGA
GTGCAAGTGCATGGATAAACTAGTGAATAATTAATTAGCAGCTAAAATCCAAGGATAGTT
ATAATACACGAGGAAGAGAAGAAGTATGCTCCAGAATAATAACATCCTGCAGTTGGTGCT
CCCATTAAGCAATCAGTAAATAATATTATATCCTCAAGTACCCCAAGATCCGGGAGTAAT
TTACAAGGAGAGAAATAGGTCAATTTTAATATTTGTGATAATTAACAGCAGCTGAAGCCA
ATAAATTTCCTAGCGGCTCAAACAAACTAAGATAGAAAGAAAAAAATCAAAAGATTTCAA
ACAGATAAAATGATTATGAGTCACTATCAAATAATTAAAGTTATCGGAAAAGGGTCATTT
GGGGAGGTTACTAAAGCCAAAGATTTGCGAACAAATAAATTTAGAGCAATTAAGAAAATA
AAAAAGTCAGCTGTATAGTAAGCTGGGACTGGATTCTGTGATGGAGGAGAGCTTTTTGAT
TAGATTACTTAATGTGGAAATTTTTCAGAAAATATGGCAGCAGATATTATAAGATAAGTG
CTATCAGCTGTAGTTTATTGCCACTAGCATAATATCGTCCATAGGGATTTAAAACCTGAA
AATTTATTACTAGAATTCAAGAGAACTCCTGAAGAAGGAAATAATGTTAAGGTTATAGAT
TTTGGTACATCTATTGAATATAGTCCAGAATAGAAATTAAGAGCGAGACTTGGAACAGCT
TATTACATAGCTCCTGAAGTTCTAAGAGGTGAATATGACGAAAAATGTGATGTATGGAGT
TGTGGAGTTATTCTTTACATTTTACTATGTGGATACCCTCCATTTAATGGAGATACTGAT
TCTTAAATTTTTGATAGAATAAAATCAGGTAAATTCATTTTTCCCTCTCCAGAGTGGGAC
TGTGTTTCGTAAGAAGCTAAGAAACTTATAAAACACATGCTTGAGTTTGACCCTAAAAAG
CGTATTTCTGCCTAAGTAGCTATATAGGATGATTGGCTCTAAAATTTCGTTCGAAATGAA
AGAAAGCTTTAGGCCTCTATATTCCAGTACATCGCCAATTAATTAATCTCAACTGATGAA
GAACAGGAACTCCGAAGAATCTTCTAAGCATTAGATGAGAATGGAGACGGAGTCGTAACC
AGAGATGAGCTTCGAAAGGGTATAGATTTATTTTAGACAACTTTTGGATTGGAAGGCGAA
TTCCTAGATATTGATAACTTGCTTTAAAAAATCGATATCGATGGAAGTGGAAATATAGAC
ATCAAGGAGTTCATCACGGCGACTATGAATCTAAAAGATGTAATTCATGGCAAGCAGCTC
AAACAAGCATTTAATCTATTCGATATTGATGGAAATGGTTAAATCACAAAGAAAGAATTG
TAAAGGGTTCTCGGGGGAGTTTTGAAGCTTTCTGAATCTTAATGGGATGAATTTATTAAA
GATATTGATATAGACAAAGATGGAACAATAAATTTTGAAGAATTCAGGGCGATGATATCT
TAAATCACGAAAATATGA


>Contig18581.0.g102(protein)
MKAPLSRTTLTTLQIASQMSLHMHHQGEVKLRIKAHWPKERAGEVQLHYSHIQLCLGGNI
AVNLQVFDPNSRVIIQTDGRVQVHGQTSEQLISSQNPRIVIIHEEEKKYAPEQQHPAVGA
PIKQSVNNIISSSTPRSGSNLQGEKQVNFNICDNQQQLKPINFLAAQTNQDRKKKIKRFQ
TDKMIMSHYQIIKVIGKGSFGEVTKAKDLRTNKFRAIKKIKKSAVQQAGTGFCDGGELFD
QITQCGNFSENMAADIIRQVLSAVVYCHQHNIVHRDLKPENLLLEFKRTPEEGNNVKVID
FGTSIEYSPEQKLRARLGTAYYIAPEVLRGEYDEKCDVWSCGVILYILLCGYPPFNGDTD
SQIFDRIKSGKFIFPSPEWDCVSQEAKKLIKHMLEFDPKKRISAQVAIQDDWLQNFVRNE
RKLQASIFQYIANQLISTDEEQELRRIFQALDENGDGVVTRDELRKGIDLFQTTFGLEGE
FLDIDNLLQKIDIDGSGNIDIKEFITATMNLKDVIHGKQLKQAFNLFDIDGNGQITKKEL
QRVLGGVLKLSESQWDEFIKDIDIDKDGTINFEEFRAMISQITKI