Identifiers and Description

Gene Model Identifier

Contig13114.0.g70

Standard Name

STK122

Aliases

Contig13114_0_g70

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001609306.999054974866289e-109Protein kinase domain containi
ng protein
SGDYFR014C3.00039543526891e-44CMK1 SGDID:S000001910, Chr VI
from 173877-172537, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13114.0.g70(coding)
ATGGGTGCTTGTTAAAACTCAATGGCTACTTTGGTTCATGAAAATAAGTCTTCATCACAC
AGTTCTACTGTCTCTTCCTTTGAACTGTTGAAATCCTATAAAGACATTCAATAGAAAGAA
TCAAAAACAAAAGTTATAAAGGATCTGAAGATAACCAAACAGCTCTTTGTGACAACTAAA
GATCAGAAATTTCAAGATAATTACAAATTGTCAACTTTCCTTGGTGAAGACATCTTAAGA
CAGTTAGATCATCCAAATATAATCAAATTATTTGAAATCTACGAAGATTCCAGGAATTTT
TATCTTGTTCAAGAGCTTGTCTCTGGCGGAGAGTTGTTTGAGGAGCTCATAAAGAGAAAG
AAGTTCAATGAGAAAGATGCGGCTCAGATCATCTCAAAAGTATTAAGTGCTGTCTCCTAT
TGTCATGAAAACAATGTCATACATAGAGACATAAAACCTGAAAATATACTGATAGACTGG
AATAATGATCATGAAATTGATGTAAAACTAATAGACTTTGGCGCAAGTTTATTTCATAAT
CCTAAGAAATTTCAAACTGAAAAGTTTGGCACTGTCTATTATGTGGCACCTGAAGTATTA
TTAGGACATTATGACAAAAAGTGCGATGTCTGGAGTATTGGTGTGGTTTTATTTGTTTTA
TTAAGTGGGGAAGCACCATTTCAAGGTGCAAAAGATTTCGACATTTTAGAATAAATCAAA
ACTGGAAAATTTGAGTTCAAATCACCTATTTGGGCTCAAAGAAGCGGTATGTGTAAAGAT
ATGATAAAAACACTTCTTCACTTTGATTATAAAACTAGAATTGATTGTACTTAAGCACTT
GATCACCCATGGATTAAATAAAAGGTTCATTTGGAGTTATCTAAGATGCATTTAAGCATG
GCTTTTAAAAATATGCAAAGATTTTCTGCGAAAAATAAACTTCAAGAAGCTGCAATGACA
TATATAGTGTTTTAATTAACATCTGCTGATGAACAAGAAGATATGATAAAATCTTTTAGA
AAATTCGATAAAAATGGAAATGGCAGTATTTCCCATCTGATTTGGAGTAGAGTGGACCTT
GATGGGAATGGAAAAATTGACTTCACTGAGTGGGAAGTTGCAACAATTAATAAAAAAGAT
GCACTCACTACGCGAAAGCTTAAGAAAGCCTTTGACATGTTTGACCTTGATAAGTCTGGT
TCAATATCTGCCTTGGAGCTAAAAAAAGCAATGGGGTCATTTGTTGGAGACTTAATATCT
GATAATGTTTGGAAGAAAATGATAGCTGAAGTTGATAAGAATGGAAATGGAGAAATTGAT
TTCGAAGAATTCGCAAAAATGATGCAAGTCCTGCTGGACTAAGGCAATGGAGAAGATGTA
GAGGAGTACTGGTAAGTATGA


>Contig13114.0.g70(protein)
MGACQNSMATLVHENKSSSHSSTVSSFELLKSYKDIQQKESKTKVIKDLKITKQLFVTTK
DQKFQDNYKLSTFLGEDILRQLDHPNIIKLFEIYEDSRNFYLVQELVSGGELFEELIKRK
KFNEKDAAQIISKVLSAVSYCHENNVIHRDIKPENILIDWNNDHEIDVKLIDFGASLFHN
PKKFQTEKFGTVYYVAPEVLLGHYDKKCDVWSIGVVLFVLLSGEAPFQGAKDFDILEQIK
TGKFEFKSPIWAQRSGMCKDMIKTLLHFDYKTRIDCTQALDHPWIKQKVHLELSKMHLSM
AFKNMQRFSAKNKLQEAAMTYIVFQLTSADEQEDMIKSFRKFDKNGNGSISHLIWSRVDL
DGNGKIDFTEWEVATINKKDALTTRKLKKAFDMFDLDKSGSISALELKKAMGSFVGDLIS
DNVWKKMIAEVDKNGNGEIDFEEFAKMMQVLLDQGNGEDVEEYWQV