Identifiers and Description

Gene Model Identifier

Contig16886.0.g73

Standard Name

STK12

Aliases

Contig16886_0_g73

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001609303.998941839720987e-159Protein kinase domain containi
ng protein
SGDYFR014C9.997652352281279e-57CMK1 SGDID:S000001910, Chr VI
from 173877-172537, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16886.0.g73(coding)
ATGGGTTAGTGCTGCACTCCCTCTAGAACTACTAAAATTAATCCGGAAACTCCTTAGCCC
AAGGAATCTTCTTAAGGTCTAGGCTCAAATGACTTGATTCTTAGTAAGAAGTAATTTGTG
TTTGAGCACTCTAGCGATAACATAAGAGAAGACTATCTCATTGGAAAAATACTGGGAACT
GGGGCGTTTGGAGAAGTGAGGCTTTGTACGCATAGGAAAACAGGGGCTAAGAGAGCAGTC
AAAATAATTAAAAAAAGCTTTTTGAAAGGAAAGGAAGAAGTTCGATTCCTTTCTGAAATT
GAGATTCTTAAATAAATGGATCATCCGAATATAGTGAGATTATTTGAGGTATATCAGGAC
CCGAAAAGGTATTTTATTGTAACTGAGCATTGCTCTGGAGGTGAACTATTTGATTAAATA
ATCAAGAGGCCGTATTACAGTGAGAGAGACGCAGCTCTCATCATTAAACAGGTGCTCTCA
GCAATATCATACTGCCACTCAAAGAATATAGTACACAGAGACCTCAAACCTGAGAATTTA
CTTTTAGAGTCAGAGGGATAAGGTTCAATAAAAGTTATTGATTTTGGTACTTCTCAGGTA
TTTGATCCAACTGCTAAGATGCACTAGACTTACGGTACACCTTACTATATAGCACCTGAG
ATCCTTGCTGGAGAATATACAGAGAAGTGTGATATTTGGTCTTCAGGTGTTATATTGTAC
ATCTTATTATGTGGGAGACCTCCTTTTGATGGCGACAACGATGATGAAATTCTAGAAAAC
GTGGCCAAAGGAGTTTATAAAGTGAGTGGTCCAATATGGTCGAGAGTGTCAGCTGAGGGG
ATTGATTTAGTCAAGAAAATGCTCAATTTCGATTAATACAAACGTATAAGCGCGGCTCAA
GCTATATAACATTAGTGGATTGTCAAGAATACTGAAACTATAGTCTTCGATGAAATAATA
AATTCAGAAGCATTGAAGAATTTGAAGGACTTCAATGCCAGCACTAAACTCCAACAGGCC
GCCTTAACATTCTTAACTACTCATTTGACAACTAAAGAAGAAATGAATGAGGCTTAGAAG
GCTTTCCAAGCTCTTGATACGAATAATGATGGAAGACTTTCTAGGGCTGAGTTAATGGAA
GGATTCGCAGAGACGATGGGTTAAACAGCGGCTGAGATAGAAGTAGAAAGAATCATGCAA
GCCGCGGATCTTGATAAAAACGGTCACATAGATTATTCAGAGTTCATAAACGCCACTATT
GACAAGAGAAAGTTGCTCTCTAAGGAGCGACTTAAAACTGCCTTCCAGTTATTTGATAGA
GATGACAACGGATTTATCAGTGCGTAAGAACTCAAGCAAGTTCTGGACCAGGGCAAGAAA
TTTGATGAGAAAGTTTGGCACATGATGATCTCAGAGGTTGACTTCAATGGAGACGGAGAG
ATTTCATATCAAGAATTTGAAAGAATGATGGAGAAACTTCTCAAATGA


>Contig16886.0.g73(protein)
MGQCCTPSRTTKINPETPQPKESSQGLGSNDLILSKKQFVFEHSSDNIREDYLIGKILGT
GAFGEVRLCTHRKTGAKRAVKIIKKSFLKGKEEVRFLSEIEILKQMDHPNIVRLFEVYQD
PKRYFIVTEHCSGGELFDQIIKRPYYSERDAALIIKQVLSAISYCHSKNIVHRDLKPENL
LLESEGQGSIKVIDFGTSQVFDPTAKMHQTYGTPYYIAPEILAGEYTEKCDIWSSGVILY
ILLCGRPPFDGDNDDEILENVAKGVYKVSGPIWSRVSAEGIDLVKKMLNFDQYKRISAAQ
AIQHQWIVKNTETIVFDEIINSEALKNLKDFNASTKLQQAALTFLTTHLTTKEEMNEAQK
AFQALDTNNDGRLSRAELMEGFAETMGQTAAEIEVERIMQAADLDKNGHIDYSEFINATI
DKRKLLSKERLKTAFQLFDRDDNGFISAQELKQVLDQGKKFDEKVWHMMISEVDFNGDGE
ISYQEFERMMEKLLK