Identifiers and Description

Gene Model Identifier

Contig697.0.g29

Standard Name

STK119

Aliases

Contig697_0_g29

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002183105.997731685152085e-122Protein kinase domain containi
ng protein
SGDYPL153C3.999458587140588e-43RAD53 SGDID:S000006074, Chr XV
I from 264192-261727, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig697.0.g29(coding)
ATGGGAGGTTGTTTAGTTTTGATGGCTGAGTAGTATCTACAGCGAAGGAAGCAAAGAGGT
TCCAAACAAGAATAGGAATTTCACAGTATCAGAAAAGCAAACGTAGTAAATGATAAAGAT
GAATTTTAGATTGAAAAGGGAGATTTGGTGTTTCAGAGATCTCTAAATGAGTTTAAGGAT
AACTATGAAGTTACAAATTAGGTATTAGGATCAGGTGCCTTTGGAACAGTTCAAGTATGC
TACTATAAAAAATAGCAAAACCAAAAGAGAGCGGTTAAAATGATTAAGAAAGATTTCTTA
CTTTTTCAAGATGACGTACGACTTCGCTACGAAATAGATATTTTAAGATATCTAGATCAT
CCAAACATTCTCAGACTTTATGAGATTTATGAAGACAGACATAATATTTACTTGGTCACT
GAGTTATGTGAGGGACAAGATTTATGGGATGATATTGCGCAAAGAGAAAAATTAACTGAA
AATGATGCAGCTGAAATTATGCAATAAATCTTATCTGCTGTTGCTTATTGCCATAGAAAA
AATGTTTGTCATAGAGATATAAAACCTGAAAATATCATAATTAGTCATCCTACCCATTCA
GAAAAAGACTGCTAAAATGGGAATATAGAAGGTCTTAAGAATAGAATCAAACTAATAGAC
TTTGGTACTTCTCAGGTTTTCTCTAAAGTCGAGAAATTGTAATCGTTATAAGGAACTTCT
GTATATGTAGCACCAGAGGTTATTGAAGGAGAATATGATTAACTATGTGATGTGTGGAGC
ATAGGAATTATACTATATATTATGATGATAGGCAAATCTCCTTACAAAAGTAAAATATAG
AGCGAGATCCTTGAAGAAGTTAAAGTAACTCAAATTAAAATTGAAGGATCTGAATGGGAA
AACAGATCAGAAGAAGTCAAAGATCTTTTGAGGCAGATGTTGAATAAAGATCCAGAACTA
AGAATAACAGCTAAATAAGCTTTAAAGCATTAATGGTTTCAAAAACAAGCAATTACTCAT
AGAGATTATTAGTCAACTGTTGAAGCCTTCATAAATCTCAGAAATTTCAATGCTATTTAC
ACATTTATGGTTTGCTAATTCTCTTCACAAGATGAAAAAGATAGGTTATATAATTCTTTT
CAAACTCTTGATTTGAATCACGACGGCAAATTAACGATTGACGAATTGGTTTAGGGTTAT
AAAATTGTTTCACCACATTTAAGTGATGAACTTATTCGATAAGAAGCTGAACATATTATG
AAGATCGTCGATTAGGATGCAAACGGATATATAAGCTTTTCTGAATGGGAAAACGCAAGC
ATAAACAAATTTGATATGCTTTCTCACAAGAAACTTCGCTCTGCTTTTGAATTATTTGAT
AAAGACAACAGTGGAAAGATTTCTGTTTAAGAGATTCAAGAAATTTTAAGTTAAGGCAGT
CAAGTGTCAAACTCGAATGTATGGGAAGAAATCATAAAAGAAATTGACCAGGATGGGGAT
GGGCAAATTAGCTTTGAGGAGTTTTACTATATGATGCAATAGATACTTAAAGACAGTCAC
TAAAACATGAATAAAAATGATAGTCAATAGAATATTGGAAGAAATTCGATTAAAAACAGA
GCAACTGATTTACCTTATTTCAGAAAGGAAAGTGATACTCTTTAATTAAACACTATAAAA
TTGGATTTAGTCTAGAAAGATTTAAAGGCTAGTGAGAAAGGACCGAGCAATTAAAATTTA
GATTAAAACAATAGCTCTAGTATGTATAGATTATCTGAAGGGGTTGAGGATGAGCCAAGA
ATAAATATTTAAATTAAATAAAGTTAATAAAGAGAAAGGAGAATCTGA


>Contig697.0.g29(protein)
MGGCLVLMAEQYLQRRKQRGSKQEQEFHSIRKANVVNDKDEFQIEKGDLVFQRSLNEFKD
NYEVTNQVLGSGAFGTVQVCYYKKQQNQKRAVKMIKKDFLLFQDDVRLRYEIDILRYLDH
PNILRLYEIYEDRHNIYLVTELCEGQDLWDDIAQREKLTENDAAEIMQQILSAVAYCHRK
NVCHRDIKPENIIISHPTHSEKDCQNGNIEGLKNRIKLIDFGTSQVFSKVEKLQSLQGTS
VYVAPEVIEGEYDQLCDVWSIGIILYIMMIGKSPYKSKIQSEILEEVKVTQIKIEGSEWE
NRSEEVKDLLRQMLNKDPELRITAKQALKHQWFQKQAITHRDYQSTVEAFINLRNFNAIY
TFMVCQFSSQDEKDRLYNSFQTLDLNHDGKLTIDELVQGYKIVSPHLSDELIRQEAEHIM
KIVDQDANGYISFSEWENASINKFDMLSHKKLRSAFELFDKDNSGKISVQEIQEILSQGS
QVSNSNVWEEIIKEIDQDGDGQISFEEFYYMMQQILKDSHQNMNKNDSQQNIGRNSIKNR
ATDLPYFRKESDTLQLNTIKLDLVQKDLKASEKGPSNQNLDQNNSSSMYRLSEGVEDEPR
INIQIKQSQQRERRI