Identifiers and Description

Gene Model Identifier

Contig1469.1.g41

Standard Name

STK114

Aliases

Contig1469_1_g41

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006284403.0014466598835893e-101Protein kinase domain containi
ng protein
SGDYAR018C5.998312950603665e-35KIN3 SGDID:S000000071, Chr I f
rom 171703-170396, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1469.1.g41(coding)
ATGTCTATAAATTATTCCCAAACTTTCGGAGTTAACAGCTCATTAGATGATTTTACTGTC
CTTAATAAAATAGGAGAGGGATCTTATTCGTCAGTGTATCACATAATCAGGAAGGAAGAT
TAAGTGCACTATGCTCTTAAAAAAGTTAATATGGGAAATTTAGGCGAAAAAGAAAAGGAA
AATGCCATAAATGAAGTCAGGATATTAGCATCTATTAAACATCCATGTGTGAGCTCTTAT
AAGGAAGCATTTATTGATGAAGCCAGTTAGAGTTTATGTATCGTGATGGAATTGGCTGAC
GATGGGGATCTATATTAAAAAATTTAAAAGTTGGCGCAGAGTCAATCGTATTTTCAAGAA
AATGATGTTATATTTGGATTGAAAGCCTTACATGACCTCAATATTATGCATAGAGATATT
AAGTCAGCAAATGTTTTTACAAACAAAGACGGGTCTGCTAAGTTGGGAGATATGAATGTG
TCTAAGGTAGCTTCTAGAGAAGGTTTAAATTATACTTAAACTGGCACTCCATACTATGCA
AGTCCAGAAGTATGGAGAGACGAGCCTTATACTTTTGTCAGTGATATATGGTCCTTAGGT
TGTGTTCTTTATGAGGCACTTACTCTTAAGCCTCCATTTCAGTCTACAGACATGGGGGGG
CTGTATAAGAAAGTTTTAAAGGGTCACTATTAGAAAATACCCATGCATTATTCAGCAGAT
TTATCAATAATCCTGAAATAAATGCTATAAGTTAAATCAGAGAATCGACCCAACTGTGAA
CAATTAATATAGATGCCTATCTTTATGAAAAAAGCTAAGTTTTACTATCCTCAATTCGTT
TAGAATTATGAGATGATGGACCAATCTATTTTGTTAAAAACAATTAAAATACCAAAATCC
TTGATTTAATCAGAAGAGACTAATTTCTGGAATGATTTATCTTAAAGATTGCCAAAGCCT
AATTATGAAAGAGATTCTATAGGTGGCTAAACCGAAGATAATTATGACTTGCCATCGAAT
AGGTCACATCTAAAAAACAATCAGACTTCAAGCAACTAAAATAATGAATCGATTTCTAAG
ATTAACCTACCTCAGATTAATAGTTTAAAATCCATTAAGGGCAAAGAAAGCTCACCAAAT
CTCCTCAGAAGAAAAAGAAACAATAAGAATAAAAGAAGTTTTGAAATTCACAACAGCAGC
TTAATCAAAAATTAATCTATGGAAATGTATGGAATATCAGAGAATGAGGATGATGTCATA
GAGCGAGACTATTCCCTTGATATAAAACATTTGAATTCTCAGTCGATGCTCTTAAATGAA
ATACCAAGTCATTCGAGAATAAACAATAACAATTATAGCATGATTGAGACGCCTATAGTT
GCCAGCTAGTATGAATTGAATAGAGAAGACGATACCTATTCTTACCAAAGAGAAGTATAA
AAAAGAATTTTGCTTGGAAAACCTATTAAGCATAACATAAATTCTTTGTAATCAAAAAAG
AACACAATATCAATCAATAAGCCTTAACTTCAGTTGCCAGCTTAGAAAAAGAATAATTCA
TTGATGTATGACGATTATATAAAATCCTACAAAATTCCTCAATCCATTTTAACTCCACTA
TAAGATAACTAGTTGCTTCAAGTTCAAAAATAATCCTCAAATCTTTCTGTTAATGAAAGA
GTTTAATCAAACAAAGAATCAGGTTTGCTGCCTCGAATTAAGAATGAAAAAACTCGAAAC
ATAAACGAATATTAAGACTCAGTGCCCACTACAACAAATAAGTATAGATACTAATCAGAG
CTAAATAACGGTAGCATGTCAAATAACTACAAAAAATCAGTGCTTTTAAAGAATCATGCT
TATTAGCATTTGTAACTATAAAATAACTCAGTGTCCTCTTCTTCTTAATTGGCCTCCCAT
TAATCTCACTCCAGCCTAGGAAAGTCTTCAAGAAGTATCTTGCTTAAAAATCAAATTGGA
ATCATTATAAAAAACGAGAATCCTAATTAAAACCCTTCAAAAATAAGCTCTAACTAATCC
TATAGAATACAATCAAATACTAGTAATTTACAAATTTTGGACAAGCCCTAATTAATTCAA
CCTATGAAGCTGAATTTAAATTCTAATCACAATATCACATCAGACTTGCAATCAAACAAA
TCCTAGCAAATATAAAATCCAAATTAGCTTAATAGAGAATTCAAGAGCAACCTGTATCAA
AATATGCAGTAGTAACTTACTATGAATTTAAGTAAGAATTATTCAAAGGAAAATCATTAA
TAAAGTCAGATGGGAATTATTGGAGTCTCTGGCTAGTATAAAATTTCCCTCACGAATAAA
ACTAACACTCAAAAGTAAAGCAATCTTTATTCTTAGAAGTAAAGTTATCACTCTCAACAT
CACAACAGCGCAGCTGGCTTGATTTAGCTATAGCAAAACCAATTAAATTAAGGACTTTAA
GGCAGCTCGAACGTTTAGAAAAATGTTCTAGGTGGTGGTTTAGGAGCTATGAGTTTGTAG
AATATATAGTAATAAATCTCCAATTAGTCTATGATCTATCAATTGTGA


>Contig1469.1.g41(protein)
MSINYSQTFGVNSSLDDFTVLNKIGEGSYSSVYHIIRKEDQVHYALKKVNMGNLGEKEKE
NAINEVRILASIKHPCVSSYKEAFIDEASQSLCIVMELADDGDLYQKIQKLAQSQSYFQE
NDVIFGLKALHDLNIMHRDIKSANVFTNKDGSAKLGDMNVSKVASREGLNYTQTGTPYYA
SPEVWRDEPYTFVSDIWSLGCVLYEALTLKPPFQSTDMGGLYKKVLKGHYQKIPMHYSAD
LSIILKQMLQVKSENRPNCEQLIQMPIFMKKAKFYYPQFVQNYEMMDQSILLKTIKIPKS
LIQSEETNFWNDLSQRLPKPNYERDSIGGQTEDNYDLPSNRSHLKNNQTSSNQNNESISK
INLPQINSLKSIKGKESSPNLLRRKRNNKNKRSFEIHNSSLIKNQSMEMYGISENEDDVI
ERDYSLDIKHLNSQSMLLNEIPSHSRINNNNYSMIETPIVASQYELNREDDTYSYQREVQ
KRILLGKPIKHNINSLQSKKNTISINKPQLQLPAQKKNNSLMYDDYIKSYKIPQSILTPL
QDNQLLQVQKQSSNLSVNERVQSNKESGLLPRIKNEKTRNINEYQDSVPTTTNKYRYQSE
LNNGSMSNNYKKSVLLKNHAYQHLQLQNNSVSSSSQLASHQSHSSLGKSSRSILLKNQIG
IIIKNENPNQNPSKISSNQSYRIQSNTSNLQILDKPQLIQPMKLNLNSNHNITSDLQSNK
SQQIQNPNQLNREFKSNLYQNMQQQLTMNLSKNYSKENHQQSQMGIIGVSGQYKISLTNK
TNTQKQSNLYSQKQSYHSQHHNSAAGLIQLQQNQLNQGLQGSSNVQKNVLGGGLGAMSLQ
NIQQQISNQSMIYQL