Identifiers and Description

Gene Model Identifier

Contig12409.0.0.g15

Standard Name

STK101

Aliases

Contig12409_0_0_g15

Description

EF hand

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011640909.001992589090134e-64Protein kinase domain containi
ng protein
SGDYKL101W1.000361553249356e-16HSL1 SGDID:S000001584, Chr XI
from 248920-253476, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12409.0.0.g15(coding)
ATGTGCACTCCATGTGGATCACCTTACTACATTGCACCAGAAGTATTCTTATAAAGTTAT
GATGAAAAATGTGATATATGGTCTATGGGTGTAGTCCTATATATTTTATTGTCTGGCAAA
GTTCCCTTCCCTGGTGAGTCCCACAAAGAGATTATTGAAAATGTTCTTCGAGGAGAATTT
ACCTTCGAACATGACAGTTTCAATAGTGTTTCTAACCTGGCAAAGGATTTAATTAGCAGA
TTGCTAGTAAAAGATGTTTAAAAACGGTATTCTGCGGCTGAAGCATACAGTCATCCTATG
ATCTAAAATATAGAAAGTAATCTTGAGACTTCAATCGCACCTGAGGCGTTTGAGAATATG
AGAAAGTTCATTGAAGCAGCAAACTTTAAAAAAGCCACGCTTGTATTAATGGCTTCAAAA
CTACCAGAAAAGGATTTTGAAGAGCTGAGAAAACTATTCATAGCTATAGATAAAAATGGA
GATGGAAAAATAGCTATGGACGAATTTGTACAAGCTTTAATAGATTACGGAATAGAATAT
ACTTTTGAAGAGACATCATAAATGGTGAACAAGCTTGACATCAACTTTAATGGGTATATA
GATTACACAGAATTCATAGCAGGTTGCATGAAATCTAAAATTTATCTTTAAGAGGACCAT
CTAAGAATTGCTTTCTCTTATTTTGACAAAGATAATAATGGCTTCATTAGTCTTGAGGAA
TTGACAAGCGTTTTGGGGGGCAATAGAGTTGGAATTAAAGATTCAGAAATTGAACTTTTA
ATGGGAGAGGTAGATTTAAACAAAGACAGATTCATTGACTACTCAGAATTTTTGGCAATG
ATGAAGAGGGATTTAAGAAGTGAATTGAGAAAGAGCGAACTAAGATAGAGTGAAATGAGA
AGAAGCAAGCTAAAGAGCAAGATATCGAATTAATGA


>Contig12409.0.0.g15(protein)
MCTPCGSPYYIAPEVFLQSYDEKCDIWSMGVVLYILLSGKVPFPGESHKEIIENVLRGEF
TFEHDSFNSVSNLAKDLISRLLVKDVQKRYSAAEAYSHPMIQNIESNLETSIAPEAFENM
RKFIEAANFKKATLVLMASKLPEKDFEELRKLFIAIDKNGDGKIAMDEFVQALIDYGIEY
TFEETSQMVNKLDINFNGYIDYTEFIAGCMKSKIYLQEDHLRIAFSYFDKDNNGFISLEE
LTSVLGGNRVGIKDSEIELLMGEVDLNKDRFIDYSEFLAMMKRDLRSELRKSELRQSEMR
RSKLKSKISNQ