Identifiers and Description

Gene Model Identifier

Contig22582.0.g104

Standard Name

SSRP1a

Aliases

Contig22582_0_g104

Description

Structure-specific recognition protein (SSRP1)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam03531 ) Structure-specific recognition protein (SSRP1)
  • ( pfam08512 ) Histone chaperone Rttp106-like
  • ( pfam04889 ) Cwf15/Cwc15 cell cycle control protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYML069W9.99562814099401e-84POB3 SGDID:S000004534, Chr XII
I from 135500-137158, Gen...
T. thermophilaTTHERM_000490804.001968334034435e-68Structure-specific recognition
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22582.0.g104(coding)
ATGTCAAACAAAGTTGTGAGCACCAAGGGCTGGAACTGGGGTTACTACAACCTCGAGAAG
GAAAACATGAGTTTTACGGTGAACGGTCAACCATGTTTCATCGTTAACTATAAGGATATT
GCACTCTCTACTGCCACTGGCAAGAACGAAGTCACTTTTGAATTCCAAGTGGACAGTGAA
AATAAAAACGATAGAGCAGATATATTGACTGAGATGAGATTTTATGTTCCAAACAGTGAA
CTTGACAGTCTAGAGGAGGAGAAAAAGAAGGAAGAGACTGGAAAGGAAGAAGAGGAAAAG
AAAGAGAAGAAGGAAGATGGAGCTGCTGATGAAGAAGAAGATGATGAGGAAGAAGAGGAG
GAAGAAATTAGTATCACTCCAGCTCAGATCTTCAATGAGAAAATAATCAAGGCTGCGGGA
ATTGGCGAATTTGCTGGTGAAATGATAGCTTCTCTCTCTGAATTACCAATGCTCATCCCA
AGAGGAAAGTATTCCTTCCAATTGTACTCCTCTTTCGCTAAATTGCATGGAAGAACTAAT
GACTACAAAATCCAATATAAAGATATCACCAAGGGTTTCCTATTACCCAAACCAGATGGT
ATCCACATGGCCTATGTTCTACATTTGAAGGTACCTCTACGTTAGGGTCAAACTCTACAT
CACTATATTCTCCTACAATTTGAAAGAGAAAAGACTGTCAAAGTACACATTAATCTTTCT
CCAGAACAGATTAAAGATCAATATGGCGATAGATTGACATCAGAGCTTGAAGGTCCTCTA
TATGATGTGATCTCAAAGCTATTCAGAGAACTTATCAAGATTAACATTCTGATCCCCAGT
GAATTCAAGTCAAGTAAGAAGGATGATGCTATTAAATGCAGCGTGAAAGCAAGTGATGGC
TATTTATACCCACTGAAGAGCAGTATCATTTTCATTCATAAGCCAGTCATATATCTCAAG
CACACTGAGATCAAGTTCGTGGAGTTCAGAAGAGTCGGACAGATTAGCAGTGGCATCCCA
AGTAGATCATTTGATATGACTATCACCAGTCTCAAGGACAACCTTGCCACTACTTTCGCA
GGTATTGACAAAGCTGAGCACAAAAACCTTGTTAACTACTTGAAGTCCAAGAACATCAAG
ATGAGAAGTGTTGATGTCGAGACTAACCAGCAAGTAGACTTCGATGACGACAGTGAAATG
GAGGAGGAAGAAGAGGAAAAGGGTGCTGCAGGTGGCAAGAGAGTAAGAAAACCAGTTGGA
AAGACTCAACTGCCTGAAGAAGATTATGACGATGAGGAAGACGATGAGTCTTTCAATGAT
GAGGGAAGTCCCAAAGAAAGCGATGAAGACGAAGAGATGGACGAGGATGATGACAGTGAT
GTCTCTATGGTTGAGGACGACTTAGACGATGAAGTGAAGCAGCTACAGAAAGAAGCACCC
AAACTGAGTGGAAAGAGAAAAGGCAGAGGAGGTGCCAAGGATGACGAGGATAAAGAACCA
AAGAGCGACAAGAAAAAAAAGAGCAAGAAACACAGTCAGGACTCATGA


>Contig22582.0.g104(protein)
MSNKVVSTKGWNWGYYNLEKENMSFTVNGQPCFIVNYKDIALSTATGKNEVTFEFQVDSE
NKNDRADILTEMRFYVPNSELDSLEEEKKKEETGKEEEEKKEKKEDGAADEEEDDEEEEE
EEISITPAQIFNEKIIKAAGIGEFAGEMIASLSELPMLIPRGKYSFQLYSSFAKLHGRTN
DYKIQYKDITKGFLLPKPDGIHMAYVLHLKVPLRQGQTLHHYILLQFEREKTVKVHINLS
PEQIKDQYGDRLTSELEGPLYDVISKLFRELIKINILIPSEFKSSKKDDAIKCSVKASDG
YLYPLKSSIIFIHKPVIYLKHTEIKFVEFRRVGQISSGIPSRSFDMTITSLKDNLATTFA
GIDKAEHKNLVNYLKSKNIKMRSVDVETNQQVDFDDDSEMEEEEEEKGAAGGKRVRKPVG
KTQLPEEDYDDEEDDESFNDEGSPKESDEDEEMDEDDDSDVSMVEDDLDDEVKQLQKEAP
KLSGKRKGRGGAKDDEDKEPKSDKKKKSKKHSQDS