Identifiers and Description

Gene Model Identifier

Contig11250.0.g56

Standard Name

SSBb

Aliases

Contig11250_0_g56

Description

RNA recognition motif (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam05383 ) La domain
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam02829 ) 3H domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003185309.995317835403734e-19La domain containing protein
SGDYDL051W0.00000000019994075865167896LHP1 SGDID:S000002209, Chr IV
from 363952-364779, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11250.0.g56(coding)
ATGTAAACTAATTTGTCCGCAACATCACTAAACTAAAAGGAGGGAAACCCCTTACCCCAA
AAATCTTAAGATATTCCTGACCTAAAGTCCAGTGCAAACCCTGAGATTTAAATGCAAAAA
CAAAATAAAGAGTAGAACAAGAAAAAACTATCTAAATAGTAGAGGAAGAGACATTTGATG
GAAATGGAGTTGAAGAAAAAGAAAAATCCAAAGAGAAAGCTTAGAACTTTTATGAATCCA
GAATCAAACTTTATAAGAGAAGATCCTATTAAGAAACCAAATAAATTTAAGCAAAACCAA
GATCAAACCATGTTAGAGTAATCAGATGAAGCTTTGAGGCATCGATCCTTGCTGAAATCT
CTAAGGTTTTAACTTGAATTTTATCTGGGGAATTCCAACTTAATGAAAGATAATTTCTTG
TATGAAAAGCTCTAAAAGGACCCTAACCTCGAAATATCACTCTTTCTGACTTTTAATAGA
GTGAAAAAGATATTTGGGGATTCTTACATGTCAAATGAAAGTTCTGAGGCTCAAATAAAA
GCACTATAGGAATCACTGAAGTTTTCTAAAATGCTTAAATTATCTAAAGATGGGTTGAAA
GTAAAGCGCAGAATACCATTCAAGAAAAATTAAGTAGATGTAAAAGCAATAGATCAATGC
ATGATTTATGTTGAGAAGTTCCCGGTTAAAGCTATGGATATCGAGAAAATGACTTTCATT
TTCAAGAGAGCAGGCAAAATTATTAATGTATAAATGCCCAGATATCCCAAAAGTGGCTTG
CCTAAGGGTTTCGCATTTGTCGAGTACTCAAGTCCAGAAGAGGCCTAACATGCAGTTGAA
ATGTTTAACAATAAAATCGTTGAGGAACTTACAAACCCCAATCACCCTCATTACATATTC
TCTGATGAACCAATAGAAGCCCTCAAAGTGATTTCCAAAAAAGAATGGAATTTGCAAAAA
CAAGAAGTATAGAATATCAAGAGGGAACTCGCTAAGTTAAATCCAGAATCTATGTTCATT
GAAAAGAAGGCAGACAATGAAGCTTTTAGCTAAATTACGAAGCTGGATCAATTATAAAGA
TTTAGAATTTACCAATCACTATAACATTTTGCTGAACCACTACATGCAGATTTTAACAAA
GCAACTAAAGAAAGCAATGTAAGATTCTCAACTCAAGTGGAAGCATAAGCATTTATCAAT
AAAGTGCAAAACAAAACTTTACTCTAAAACGAAGGTCTCAGTTCACAAACTGGGAACATA
TTCTTAAAAGAGGGGAGAGATAAGGTACAGATAGTAGTATTGAAGGGAAAAGATCTTGAT
TAATATGTGGCATAAGCTAAGAAAGATTAGGGCGAGTATCATGGATATCTTAAGAGAGTG
AAGCAACATAAAAATCTAAAGAGAAGGTAAAAAAAGCAGTAGAGTAAGTAAATTGCTAAA
TAATAAAAATAAGTGAAAACAGATCAGTGA


>Contig11250.0.g56(protein)
MQTNLSATSLNQKEGNPLPQKSQDIPDLKSSANPEIQMQKQNKEQNKKKLSKQQRKRHLM
EMELKKKKNPKRKLRTFMNPESNFIREDPIKKPNKFKQNQDQTMLEQSDEALRHRSLLKS
LRFQLEFYLGNSNLMKDNFLYEKLQKDPNLEISLFLTFNRVKKIFGDSYMSNESSEAQIK
ALQESLKFSKMLKLSKDGLKVKRRIPFKKNQVDVKAIDQCMIYVEKFPVKAMDIEKMTFI
FKRAGKIINVQMPRYPKSGLPKGFAFVEYSSPEEAQHAVEMFNNKIVEELTNPNHPHYIF
SDEPIEALKVISKKEWNLQKQEVQNIKRELAKLNPESMFIEKKADNEAFSQITKLDQLQR
FRIYQSLQHFAEPLHADFNKATKESNVRFSTQVEAQAFINKVQNKTLLQNEGLSSQTGNI
FLKEGRDKVQIVVLKGKDLDQYVAQAKKDQGEYHGYLKRVKQHKNLKRRQKKQQSKQIAK
QQKQVKTDQ