Identifiers and Description

Gene Model Identifier

Contig19548.0.g11

Standard Name

SSBa

Aliases

Contig19548_0_g11

Description

La domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL051W0.000000004999139696582238LHP1 SGDID:S000002209, Chr IV
from 363952-364779, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19548.0.g11(coding)
ATGAAGCTAAAACTCCTCATTCCAGAGCACTTTCTCGAAGCCTTTTTCTGCTAAACCTTC
TCTAAAACTCTCGTAGTTTTTCCACTACCCCAAAACCCCTCATCTCAAACTCCAAACTCT
TTCATCTCACAGCATTTTAGTCAATAAGAACAAGCTCCAGTAATAAAAGACTTGTTGAAG
TTCATTTATGAGTCTCATAGTTTCGCATTTGATAAATAAATTAAGCCAGAGTTAGTATAT
ATCACAACTGAAGATGACTTTATGCTTCCACCGCTTGCTAGAGTTGATCAAACTTTAGAG
CAAAATCAAGTCATTAAACTCAAAAGTATAGAAAGAATACCTAAGATTGATGTTTCTACC
AAATAAACATTATAGACTTAAGTAGTTTCGAATAGTAGCGACATTTTAAGAGAAAAAGAA
TAGCTAAAAGACATAAAGGGGAATTACTAACAAAATTTGTTAACTCACAATCCAGTTGAC
TTGTTTGGGTTTAAGTAATTCAGTTAAAATCAGAGAGATAATAATTCATAAAAACTGAAG
TAAAGCCACGATATCAAAATAAAAGAAAAAGAGAAGATCACTGGAAAGAGAAGCAAATCA
GAGGGAAAGAAAAAGGTTATAGTTAAAATTAAAAGCAATTAAAAGTAGAAGTAGGAGTCT
TCATCATCTTCTTCGTCAGAGGATTCTGGTTATGAAAGCAGCAGTAGCAGTGAAGTTTAA
GAGAGAAAAACCAAGAAGATTCAGAAGAAAAAATCAAGCAAAAAGCAAGAGTCATCATCT
GAAAGTAGCAGTAGTGATAGTTCATCATCATCATCCTCGGAGGATGAAAAGCATATGAAA
AAGAGAGACTCAAAAGCTAATACCAAGACTGATAAACTAAATCAAAAATAATCAAATAAG
TCCCAGCCCATAAACGAGAAGGATATAAAGTCCAAAATTAGAAACGAATTCTCCAAAGCA
TTTATCAAATCTTCAAATGAAAAAGCACAGGAGAGCAGTAATAACAATAGTGCGCCTATT
GAATAATCATCAAAGAATAGAAATGGTGGAGAGGCATTGAAAGTTACAATGCCCAAATAG
TAATTCAATATTAAAACACCATATGAAGTTTAACAAGAGAAATCTCATAAGATGAAAGCA
TAGAATGGGTAAAGACCAGAAAATAAGCAGTAAGTAGAGAGACCATATCTTGGGAAATTT
GATCATCTCTTGCCATCGAGATAATAGCAAAATTAGCAGCAAAATAAAAATGGGAAGTAA
AATGTGAATTAATAGCAATATACATCTCCATTGAAGACTAAAAGTTAGCAAATATACGAT
TCTATCTTTGATGGTGAGGATTTAGACTAATCAAAGCCTCGTTACGATAACGATGAGGGT
CTCTATAATAAATTTACAGAAGTTTATACTATAGAAACGAAGAAACTTTAAGAGTAACAA
AACAAGAATAAAGCTTCCTCACCTCAACTTTAAGGATTGCTAGAGTTAAGTAACTACAAA
AATCATCCAGTCGTAGTAAACCTTTATGATTTTATTCATCTAACATCTGCATAGATCTTG
AATATTTCTGCTGAGATTTGGGACTATATTCATTAAAATTAAGATGTTTGCTTCTAGATT
ACAGAACCTGATCTCGTCACTTGCATTCCAAAGGTTTCTGAATTGAAACTCGGTCAAATT
ACTAGCTTTGATAAAGAGCAAAATGAATTGTAAATACAATTAAGAAAGGACTTTACTGTT
GGCGATGAAGCTGAAGAGGAAGCTTTACAAGATTTCTTTACTGAGAAATACTTGGGATTA
GGCTTGTACAATTTAAAGCTTGAAGATATAGTCAGTATGTGGATTAAGGTTAGTAAGTAA
GTTTTGCCTTAATTCTAAGAATTACTTGAAAAGAATAAAGTCGCACCTCAAGCACCATCT
TAAGAGCAAACTTAATCTACAGATAATTAGAACGGGTAACCTCCCCAAAACAAGGCAAAG
CAAGATTTCTTAAAAAACTAGCAAGAAAACTTGGATTCAGGAATTAGACGTCAAATGGAG
TACTATTTCGGAGATAAAAACTACCACAAAGATAAATACATTCAGAAGAAGGTATCTGAG
AACGAGGGCAAATATGTTCCCTTGAAAGAAATTATGAGTTTTAATTAAATGCGCAAACTC
ACAAATAATGTGGAATAGGTGGTTAGAGCATTAGAGGGGTCAAAGATTGTGGAGTTCTCA
GAAGATCAAAAGATGGTTAGAAGGAAACAGGTAAAGTAGTGA


>Contig19548.0.g11(protein)
MKLKLLIPEHFLEAFFCQTFSKTLVVFPLPQNPSSQTPNSFISQHFSQQEQAPVIKDLLK
FIYESHSFAFDKQIKPELVYITTEDDFMLPPLARVDQTLEQNQVIKLKSIERIPKIDVST
KQTLQTQVVSNSSDILREKEQLKDIKGNYQQNLLTHNPVDLFGFKQFSQNQRDNNSQKLK
QSHDIKIKEKEKITGKRSKSEGKKKVIVKIKSNQKQKQESSSSSSSEDSGYESSSSSEVQ
ERKTKKIQKKKSSKKQESSSESSSSDSSSSSSSEDEKHMKKRDSKANTKTDKLNQKQSNK
SQPINEKDIKSKIRNEFSKAFIKSSNEKAQESSNNNSAPIEQSSKNRNGGEALKVTMPKQ
QFNIKTPYEVQQEKSHKMKAQNGQRPENKQQVERPYLGKFDHLLPSRQQQNQQQNKNGKQ
NVNQQQYTSPLKTKSQQIYDSIFDGEDLDQSKPRYDNDEGLYNKFTEVYTIETKKLQEQQ
NKNKASSPQLQGLLELSNYKNHPVVVNLYDFIHLTSAQILNISAEIWDYIHQNQDVCFQI
TEPDLVTCIPKVSELKLGQITSFDKEQNELQIQLRKDFTVGDEAEEEALQDFFTEKYLGL
GLYNLKLEDIVSMWIKVSKQVLPQFQELLEKNKVAPQAPSQEQTQSTDNQNGQPPQNKAK
QDFLKNQQENLDSGIRRQMEYYFGDKNYHKDKYIQKKVSENEGKYVPLKEIMSFNQMRKL
TNNVEQVVRALEGSKIVEFSEDQKMVRRKQVKQ