Identifiers and Description

Gene Model Identifier

Contig1819.0.g56

Standard Name

SS1

Aliases

Contig1819_0_g56

Description

Ssl1-like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1819.0.g56(coding)
ATGAAACGAAACACACCATCAGACGCCAATAAAATTTACACTCGAATTCAATCAGAATCA
AAATAATTAACAACTGAACTGCGGAGGAACAGAGATTATTATGGAAACGGCGATATTTTC
ATATAGAAAAATATTGATTTAGTAAACCAGTATTTAGTCAGCATGGATGCTTATACTACA
AAAGATCTCAAAAAAGTATGTCATTTTACTTAGTCTCATAATTAATACTATTCTGTAGTT
AAAAGTAAAAGACTTTCCAAGCGGACACACATGGTTCAACAGCAAGCCCTTGTCCTTTGC
AAATGA


>Contig1819.0.g56(protein)
MKRNTPSDANKIYTRIQSESKQLTTELRRNRDYYGNGDIFIQKNIDLVNQYLVSMDAYTT
KDLKKVCHFTQSHNQYYSVVKSKRLSKRTHMVQQQALVLCK