Identifiers and Description

Gene Model Identifier

Contig15516.0.0.g97

Standard Name

SRRT

Aliases

Contig15516_0_0_g97

Description

Domain of unknown function (DUF3546)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam12066 ) Domain of unknown function (DUF3546)
  • ( pfam13821 ) Domain of unknown function (DUF4187)
  • ( pfam04959 ) Arsenite-resistance protein 2
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00096 ) Zinc finger, C2H2 type
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam12171 ) Zinc-finger double-stranded RNA-binding

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010208801.0002546821282671e-50hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15516.0.0.g97(coding)
ATGATGAGCACATCCTCTCAACACTAGTAATCACAAGAGCAGTAATAAAATCAACCCAAT
AACTAAGCTAATACCCTAGATTTAGACGACCCACTACACTCTTCAGATGATGATCAGCAG
CAGAACCAAAATTAAACAGATAAACTTGCCAAACTCAGACCTCGTAACCATTCTTCCTCA
TCTGATGATGATGAAAGCAGAAGGAAGAGAGGAGTTAATGGAGACAGGTCTCAAGGCGGC
CGATCTTAAAATGTTCAGAGATCTCGTTCTAGATCACCAATTGCCAGAGGCAGTGAAGTT
ACAGGAGATCGCAGAAGAAGAGACAGAAGAGGAGGCAGAGGAAACTCCTCGGACTCTCAG
CAGAGCAGCGACCTCAACGAGGACAATAAGAGTTCTGGCAAAAGTGAAAGCGACAACAAC
ATGCAGGATGAAGACTAGAACGACAATGACTCTAGAGATGGAGGACGCAGGAGACATCAC
AGATATAGAAGCAGCAGAGAAAGAGCTGGTGGAAATGATAGAGATCGCAGATATGGCAGA
AGAGGTGATCAAAGTCAATCATCCTCAACTAGAATTAAAATGCCTCCTCTAGATGCCCCA
CTTGTGACATTCAAAGAATTCATCCAGATGCAGCGAGGTGGTGAGTCGTTCTCCCACGAC
GATGCTCAGAGACTATATGATCATTACAAAGCAGACCACATAGATAAGCAAGCTGAGATA
TTTTTCACAATGCACAAGGATGAGTGCTGGTTCAGAGAAAAGTACGATCCACAGCAATCT
TACAAGTGGAAGCAAGAAATTGTTTTGCAGGCATAGAGTGTTTCGTCAAAGTTTATCGAG
GAATTTGTTGAAGTAGGACATGGAACTGAAAAATCTCAAAAGCTGAGTTTAGATGAAGAC
CCTAACTTTGATTATCAAAAACTAGTGAACCCTAATACTAGTGCTGAAACTGACGAGGTA
TCAGGACCTCCTCTATTTGGTTTCGATGCAAACTCCCGCACTCTTTATCTCAAACAAATT
CCTGTTAAAATCAGTAGATGGGAACTTCTTTCACATGTGAGACAGACAAGAGGTTTTGTT
TCATTTTCAATGAGTGAACCTCTAAAGACTCAAGATTTCGAGAGATACGCTTGGGTAAGT
TACGATTCAGAGGAAAATTGTAGGAGAGCAAAAGATCAATTAGATGGTCAGAAAGTTCAA
GACTTCAAGCTCTACCCAGTCAAATCCTAAACTCAACGTAAACCCATTCGTATAACTCCA
CCTCTGGCTGAAGATTCAATCAATCGTGATTTCAATCTCTGTAAGCGCTTGATTACTGAA
GTCTTCAATCAAGAGAAGCAAATTAGTGCAAGCTAATCAATTGAAAAGCTTTTGGAAGTA
TGTCAATTTTTGAATTAAACTCAACAGCTAGACTTGCTGATACTTTACCTTCGTAGAGTA
CATGCTTACTGTTTCTATTGCGGAGAAGAATACGATGATGAACGCATGTTAGCAGCTAAG
TGTGGTCCTTAACACATTCGATCTGCAAAGAAAATTACAAGGTTCGACTTGGACAATCTT
GGACTTGGCGGCTTATACTCTGGTAGTAAATCTTTTGAGGATAAGTACCTGAAAGCTGCC
AATGACAGACTTCTAAAGGGAATTAGAGAACTTGTGGCACCAGAATAAGATAAGTTATTG
ATTGAGATGAAAACCAAATACTCAGAGAAAAAAACTGTTGAAGTAAACGAAGGCCATATT
TATCAATGTGCTATGTGTGAAAAACGCTTCAAAACTCCAGATTTTGTGGAAAAGCACATT
TTTAATAAGCATGGTGAGGAGCTTGACAAAAAGTTCAACAAGTTGAGATTTGAAGATATG
CTTAAGGAAAACTACATGAGCGATCCCAATAAGTTCATTAACACCTACAACAATATAGGT
GGTGGTGGCTATGGAGGAAGAGGCGGCTACGACAGATATCACAACAACAGTGCTGCAGAT
AGACGAATGGGAGGTGGTGACAGAAGAAGGTGA


>Contig15516.0.0.g97(protein)
MMSTSSQHQQSQEQQQNQPNNQANTLDLDDPLHSSDDDQQQNQNQTDKLAKLRPRNHSSS
SDDDESRRKRGVNGDRSQGGRSQNVQRSRSRSPIARGSEVTGDRRRRDRRGGRGNSSDSQ
QSSDLNEDNKSSGKSESDNNMQDEDQNDNDSRDGGRRRHHRYRSSRERAGGNDRDRRYGR
RGDQSQSSSTRIKMPPLDAPLVTFKEFIQMQRGGESFSHDDAQRLYDHYKADHIDKQAEI
FFTMHKDECWFREKYDPQQSYKWKQEIVLQAQSVSSKFIEEFVEVGHGTEKSQKLSLDED
PNFDYQKLVNPNTSAETDEVSGPPLFGFDANSRTLYLKQIPVKISRWELLSHVRQTRGFV
SFSMSEPLKTQDFERYAWVSYDSEENCRRAKDQLDGQKVQDFKLYPVKSQTQRKPIRITP
PLAEDSINRDFNLCKRLITEVFNQEKQISASQSIEKLLEVCQFLNQTQQLDLLILYLRRV
HAYCFYCGEEYDDERMLAAKCGPQHIRSAKKITRFDLDNLGLGGLYSGSKSFEDKYLKAA
NDRLLKGIRELVAPEQDKLLIEMKTKYSEKKTVEVNEGHIYQCAMCEKRFKTPDFVEKHI
FNKHGEELDKKFNKLRFEDMLKENYMSDPNKFINTYNNIGGGGYGGRGGYDRYHNNSAAD
RRMGGGDRRR