Identifiers and Description

Gene Model Identifier

Contig14186.0.g39

Standard Name

SRRM2

Aliases

Contig14186_0_g39

Description

cwf21 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010014902.9992476920535046e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14186.0.g39(coding)
ATGTATAATGGAGTAGGTTTAACCACTGCGCGTGGTTCAGGAACAAGCGGCTACATTCAG
AAAAATCTTTCTTTCGTAGCTCCAGGGGCAAAGGCAAAGAACATGGACTACGGTAAAATT
CTTCAGTAACTCAAGGAAAATCCCCTACCCCCTCCTAGGCCACCCAACAAAGAATTAATA
GAGCATGAATAAAAGAGAAAAGTTGAGGCACATCTCTTTAAGTTGGAAAAAGAGTTAAGA
TCACATGGAAAATTAAGCGATGAAGAAATTAAGAAAAGTTTGGCAGAGGCTCGTGAACAC
ATGCTCGAAAAACTAAAGCAAGCTCCAACTTTGATAAATGCCAAAGAATCTCATTAAGCT
GCGTTGGCCAAGGAGAAACATATGGAGAAGTTGAAAAATGCACTTGGTATCTCAGATAAG
CATGAATTTGGAGCAGCTTTCGATTTGGAATTATAAGAGAATAAGAGACTTGACAGATTG
GCTGAGCTAGATCGCATTCGCAAAGAAAAAAAGAAAGCCAGAAAAGAGGCAAAGAGATAG
AAGGAACGTGAAGATTTACAAAAACAACTGGAGATGATAAAGCAAGGAAAAACTCTGGAA
TTAGAGGAAGAAATCAAGCAAGGCAATAATTCAGAAGATGAAAGTGGCAAAGAAAAGAAA
GATAAGAAAGACAAGAAATCCAAAGATAAGAAGTCCAAAAAGGCTAAGAAAGATAAAAAG
TCAAAGAAGAGCAGACGTGATTCTTCCTCTGATGACAGTGACTCTAAATCTGAGGTTTCA
AATGAAAGTGATTCAGACAATGATAGGAAGAAATTGTCGTCGTCAAAAGATAAGAAAGAT
GAGGAATTTAAAAAGGTAGACAAACATAGTAGAAGGGATGAGAGAAACCGCGATGATAGA
ATGCATGATAGAAGTAGATCTAGAGAAAGAAGCACTAAAGATAGGCATGATAGAAGAGAT
AGAGTAGACTCTAGAGATGATTACTCAAAGCGCAGAAGAGACTCCAGAGATCACAGAGAG
AGAAGAAAATCTCGATCTTGA


>Contig14186.0.g39(protein)
MYNGVGLTTARGSGTSGYIQKNLSFVAPGAKAKNMDYGKILQQLKENPLPPPRPPNKELI
EHEQKRKVEAHLFKLEKELRSHGKLSDEEIKKSLAEAREHMLEKLKQAPTLINAKESHQA
ALAKEKHMEKLKNALGISDKHEFGAAFDLELQENKRLDRLAELDRIRKEKKKARKEAKRQ
KEREDLQKQLEMIKQGKTLELEEEIKQGNNSEDESGKEKKDKKDKKSKDKKSKKAKKDKK
SKKSRRDSSSDDSDSKSEVSNESDSDNDRKKLSSSKDKKDEEFKKVDKHSRRDERNRDDR
MHDRSRSRERSTKDRHDRRDRVDSRDDYSKRRRDSRDHRERRKSRS