Identifiers and Description

Gene Model Identifier

Contig7818.0.g65

Standard Name

SRRM1

Aliases

Contig7818_0_g65

Description

PWI domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000302301.000116773704384e-19PWI domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7818.0.g65(coding)
ATGGCAGCAAGCTTTTTCAGGGGAACACACATCGACTAGAATGTTAAATTCAAGGACAAG
GATAGAGAGCTAACCAAGAAGTGGAAGTATCCTGCTGAATTCGATCTTTCCGTTGATTTA
AAAAAGGTTTAATTAGACGTGATCAACTCGTGGATTGAGAGAAGAATTATTGAGTTGATG
GGCGAGGAAGATGATATCGTCATAAGATTCGTGATTTCATACTTGGAGGATGCCCAAAAC
ACTGCAGATTAAAAACTCGACCCCAAACATCTTCAAGTTCAATTAACTGGTTTCTTGGAG
GAGAAAGCTCAAATATTTGTAAAAGAGTTGTGGGATTTGTTGCTAGCTGCTCAAACCGAG
CCAACTGGCATCCCTCCAGTGCTTATAAGAGAGAAAATCGATGAAAAAAATCGTAAGCTT
GAATAAATTCAATAAGTTAAATAATAACTTGAGAAGATTAGGAACTTTGCTGATCTACCA
CAGCAACAGAACCGTGACGATAGAAATCGAGGAGAGAAATCTGATAGATGGCAATCTAAC
CCACAAACCTCTAAGTAATCAAATCTCAAAAATTAAGATGCTGATTCTGGTAAAGATAGA
CATCGTAGATCCTCTCGCAGTCTTTCTAACAACCGAAGAAGAAGAGACGATAGAGACTAC
GATAACAGGAGAGATCGACATGAAAGAAGCGATAGAAAGAGACATAATAGAGATAGATCC
AGATCCTCCGATAGGTATCGTAATGATAGAAAAAGAGATAGAGGGCGTGATAAAGATAGA
GACTACGATAGAAGGCACGACAAAAAATCTCAGAAACATCATAGAAGAGGTGAGAGCAGC
GAAGATGAAAGAAGAGATAAGAATGGTAAACATAGACATGAAGAGAAGGATAGAAGAAGA
AATGAATAAAACAGGGAAAAATCTTAATCACCTAAAAGCGCTAATCTACCCTTAGTAAAT
GTTAACGAACAAGCTCAAAATGAAGAACAAAAAGATTGA


>Contig7818.0.g65(protein)
MAASFFRGTHIDQNVKFKDKDRELTKKWKYPAEFDLSVDLKKVQLDVINSWIERRIIELM
GEEDDIVIRFVISYLEDAQNTADQKLDPKHLQVQLTGFLEEKAQIFVKELWDLLLAAQTE
PTGIPPVLIREKIDEKNRKLEQIQQVKQQLEKIRNFADLPQQQNRDDRNRGEKSDRWQSN
PQTSKQSNLKNQDADSGKDRHRRSSRSLSNNRRRRDDRDYDNRRDRHERSDRKRHNRDRS
RSSDRYRNDRKRDRGRDKDRDYDRRHDKKSQKHHRRGESSEDERRDKNGKHRHEEKDRRR
NEQNREKSQSPKSANLPLVNVNEQAQNEEQKD