Identifiers and Description

Gene Model Identifier

Contig469.0.g27

Standard Name

SRP9

Aliases

Contig469_0_g27

Description

Signal recognition particle 9 kDa protein (SRP9)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • DNA-templated transcription, initiation (IEA) | GO:0006352
  • SRP-dependent cotranslational protein targeting to membrane (IEA) | GO:0006614
  • negative regulation of translational elongation (IEA) | GO:0045900

Domains

  • ( pfam05486 ) Signal recognition particle 9 kDa protein (SRP9)
  • ( pfam03847 ) Transcription initiation factor TFIID subunit A

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig469.0.g27(coding)
ATGGTTTACATCACAGATTTCCAAACCTTCCACTAGAAGAGCATTGATCTCCTCCAAAGA
GATTCTGTAAAGACTAGATACATGCTGAAGCATAGATAAACAGATAACGAGGCAGTTATT
AAAGTCACTAATGATATTGAAACATATCAATTCAAGATTAACGACGGTAATGCTGAACAT
GCACATGATTTTATCAGAGATATTACTTTTGCTTTTATGAAGACAGCAGCAAATAGAAAA
GGAGACGATTTAGGTCTAGGAGGTGGCATTGGTGCAGCTGAAGAAAAGAAGGGAGGCAAA
AATAAGAAGAAGGGCAAGAAATGA


>Contig469.0.g27(protein)
MVYITDFQTFHQKSIDLLQRDSVKTRYMLKHRQTDNEAVIKVTNDIETYQFKINDGNAEH
AHDFIRDITFAFMKTAANRKGDDLGLGGGIGAAEEKKGGKNKKKGKK