Identifiers and Description

Gene Model Identifier

Contig4928.0.g103

Standard Name

SRP72a

Aliases

Contig4928_0_g103

Description

SRP72 RNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • SRP-dependent cotranslational protein targeting to membrane (IEA) | GO:0006614

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001476400.00000000000009996062864481225conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4928.0.g103(coding)
ATGACTGAGGAAGAGAAAAAGACCATTTTAGGCGATCTCTACGAAAAACTTCATAAAGCT
TAGCAAAGCAGTCATCATCAGACTGTCCTAGATCACACTGATAAAATTTTGCAAGTAGAC
GGTGCTTAGGATGTAGCATCCAGGGCGAGATTGACTGCACTTATTAAAACAAAGAATTTC
GACCAAGCTCTAGAATAAATTAAAGGGAAGGAGAAGCAATATTAATTCGAGCAGGCTTAT
ATTTTCCATAGATAAGGCAAAAATAAGGAAGCCCTCAAAATCTTACAGGCAGCAACTGAT
AAGGATAACGATAGAACCAGGCATTTAATCTCACAAGTACAGTACAAATTGAACGATTAC
AAGACAACTGTGAACATTTACACTGACTTGTTGAAGACATCTTCAGAAGATGAAGTCCAA
GATATCTTGACAAATCTTTTGGCATGTGCTTCAAATCAAGATGAATTGATTGATCCAGTT
GAAAGATTGCTCGATGGCCAGTACAAGTTTGAGAAAACTTACGAGTTTTTCTTCAACTTA
TGCCAAGTGCAAATGAAGCAACAACTATACTAGGATGCTATGAAAAACTTGCAGAGCTCA
TATGACATTGCCAGAGAAGATGCTGGGTCTTCAGCAGCAATTGACCACGCTGATCAAACC
AGATTCAAGGTTCAAGAGATCCACTTGCTCAACAGCTTCTATCACGATGTAAATCAAATT
GAATACGGAAATTTGGCTAAGTTCACACTACCAAAGACTCTCAAGCATGAAAACTTAGTT
GAAATTAATATCAATGCATTCTAAGAGACTTATGAATTCAATCGCCAGTACTTGAAAGAA
TTGATTGGTAACTTGAACTGGAACAAATTCAGTGAGCGCATAGCTCAGCAACTATCTACA
AACCAAAACCTGACTAGTTAGCAGAAGAAGCTCATGCAAGTAAATTTGATTGTTGCACAG
ATCAGATCACACAAGTATGATGAGGCTAGAAAGGAGTGGGAGAAGATCACTACTCTAGGC
AATGATCACTATGCTCTTAAGGGTATTGGTGCTTATTTCTATCTAAAAGATAAGAAATAC
GATGAAGCCTTGAACTTAATTAAAAACCAAAAAGATATCTACTCAACTTTCTTGAGGGCT
TAGATTTTCTTGGCCAAGAAAGAACCCAAGGTCGCTTTCGAGACTCTTGCTTCAAACTTA
AATGATGAATTGCTGAGAAACGACGATTTCATGATCTTTTTGCTCAGATAATGCCAAAAC
TACAAATTGAAGGAAATTGTTTCTTCTTTAACAGATAAATTGCTGGCAATCAAGACCGCT
TAACAAAATAAAGAGCTTTTAATTCAATTAACAGATATCTTGGTTTCAGATAACTAAACT
AAGAAAGCCCATGACATCTTAAAGTCACTCTTTGATGTACATGGTCAATCCGATAAAGTT
GTATAGTCAAAGTACTTGAACGTGCTTGTTGACATAAATCTGAGTGAAGCTATTAAGGTT
TAATAGAAATTAAGCACCCCAATTTAAGGCTCACTTATTGATAACGATGAATACTTTAAC
TAATTAATCGAGGAAGGCATGCCAGAAAAGAAGAAGGAGAAGAAGACCAAGAATGTTGTT
CAAGAAACCAAAGGAGGAGCAGAAATCTTTATTCCAAAGAAGAAGAATAGAAAGATCAGA
CTCCCAAAGAACTTCGACCCCAAGAACCCAGGCCCAGAGCCAGATCACGAAAGATGGTTG
CCAAAGTGGCAGAGAAGCAGGTACAAGAAATACGCTAAGAAGAAGGGATTGTACTTAAAG
GGAGCATAGGGAGATGCACAGATAGATACAGATGTCACTGGTGGTATAGCTCAAAGCACA
GCACATTAAGAAGCAGTTACCCAAAAATCAAAGCATAAGAGAAAGAAGAAGTGA


>Contig4928.0.g103(protein)
MTEEEKKTILGDLYEKLHKAQQSSHHQTVLDHTDKILQVDGAQDVASRARLTALIKTKNF
DQALEQIKGKEKQYQFEQAYIFHRQGKNKEALKILQAATDKDNDRTRHLISQVQYKLNDY
KTTVNIYTDLLKTSSEDEVQDILTNLLACASNQDELIDPVERLLDGQYKFEKTYEFFFNL
CQVQMKQQLYQDAMKNLQSSYDIAREDAGSSAAIDHADQTRFKVQEIHLLNSFYHDVNQI
EYGNLAKFTLPKTLKHENLVEININAFQETYEFNRQYLKELIGNLNWNKFSERIAQQLST
NQNLTSQQKKLMQVNLIVAQIRSHKYDEARKEWEKITTLGNDHYALKGIGAYFYLKDKKY
DEALNLIKNQKDIYSTFLRAQIFLAKKEPKVAFETLASNLNDELLRNDDFMIFLLRQCQN
YKLKEIVSSLTDKLLAIKTAQQNKELLIQLTDILVSDNQTKKAHDILKSLFDVHGQSDKV
VQSKYLNVLVDINLSEAIKVQQKLSTPIQGSLIDNDEYFNQLIEEGMPEKKKEKKTKNVV
QETKGGAEIFIPKKKNRKIRLPKNFDPKNPGPEPDHERWLPKWQRSRYKKYAKKKGLYLK
GAQGDAQIDTDVTGGIAQSTAHQEAVTQKSKHKRKKK