Identifiers and Description

Gene Model Identifier

Contig14031.0.2.g40

Standard Name

SRP54

Aliases

Contig14031_0_2_g40

Description

SRP54-type protein, GTPase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003435009.997093137033517e-262signal recognition particle 54
kDa protein 1,...
SGDYPR088C7.000541856956825e-135SRP54 SGDID:S000006292, Chr XV
I from 713028-711403, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14031.0.2.g40(coding)
ATGGTATTAGCTGAATTAGGCCAAAAGATTTCATAAGCCTTGCGTAAACTTAACACTGCA
ACAGTCATTGATGAGAAGGTGCTTGGCGATATATTGACAGAAATTGCATCTGCTCTCTTG
TCGGCTGATGTGAACATAAAATATGTGGCTAAATTAAGAGATGCAGTCAAGACTATAGTC
ACTCTGTAGATGTCTCAAGCAGGAGTCGCAAATATCAGAAAGTTGATTTAGCAGACTGTC
GTTCAGGAACTAACAAACATGCTAGAGTCAGAGAACCGCCCCTACGAATTCAAAAAGGGC
AAACCTAATGTAGTCATGTTCGTTGGTCTCCAAGGATCAGGTAAAACTACTACTTGTACC
AAATTCGCCTATCACTACATGAGAAAAGGATGGAGAGTTGGTTTAGTTTGCGCAGATACT
TTCAGAGCTGGAGCCTTCGAGCAATTAAAGATGAATGCAGCTAAGATCAAGTGCCCCTTC
TTCGGTCACAAGAAAGAGACAGATCCAGTTAAAATTGCACAAGAGGGAGTGAACTTTTTC
AAGGAACAGAAGTTTGAGATTATCATAGTTGATACCTCAGGTAGACATAAGCAAGAAGCA
GCACTATTCGAGGAGATGTAACAAGTTCAAGCTGCTGTAAGTCCAGATACTTCCATTTTC
GTTATGGATAGTTCCATTGGTCAAGCTTGTTATGATCAAGCCACAGCTTTCAACAAGGCA
ATTAGAGTTGGTAGTGTTATCATCACCAAGTTAGACGGTCACGCTAAGGGTGGTGGTGCT
CTCTCCGCAGTCTCAGCAACCCAATCCCCCGTGGTATTCATCGGTACAGGAGAGCACTTC
GACGACCTCGAATCTTTCAACGCTAGTTCCTTCATCAAGAGACTCCTAGGTCTGGGAGAT
ATCGGTGGACTGGTTTAGACTGTGAAAGATGCCATTCCAGAAGACAAGCAAAAGAAGATG
GTTGAGAACATTCAGAAGGGAGAGTTCTCACTCAGGGACATGAGAGATCAGTTCGCAAGT
GTCCTCAATATGGGACCACTCAATCAAGTGGTTAGCATGATTCCAGGTCTATCATCCAAT
CTTATTCCTAAAGGTAGAGAAAAGGAGTCAACAGCCAGAATAAAGAGATTCTTGTGCATC
ATGGATTCCATGACAGACGAAGAACTCGACTGCATTAAGCCAATGAGTGATTTCCGTATC
CTCAGAATCGCAAAGGGTTCTGGGTGCAGACCAGAAGAAGTAGCTTTCCTCCTAGAGGAG
CACAAGAAGTTCGCAAAGATGGTCGAACAATTCGGAAAAATGAAACTTAACAATCAAACA
GATTTGAAGAACCTCAATCGTAATCCCAAGCAGTTAATGCAACAAATGTCAAAGGCCATA
GACCCCAAGCTACTACAATAGATGGGAGGCATGGGCAACTTAATGAACATGATGAAAGAA
ATGGGTAACATGGAAGGCATGTAAGACATGATGTCCTCTATGATGGGAGGAGGAGCTGGT
GGTGCTGGAGGTGCACCTGGTGGTCTAGGCGGCTTAGGTGGCCTAGCAAGTGCCTTAGGA
GGCGGTGGCGGTATGCCAGATCTTAGTGCCTTAGCAGGAGCTCTTGGCCGTGGAGGCGGT
GGCATGGGAATGCCCCCAGGTATGGGCGGTATGAGAAGAGGCGGTGGCGGAGGCAGAAGA
AGATGA


>Contig14031.0.2.g40(protein)
MVLAELGQKISQALRKLNTATVIDEKVLGDILTEIASALLSADVNIKYVAKLRDAVKTIV
TLQMSQAGVANIRKLIQQTVVQELTNMLESENRPYEFKKGKPNVVMFVGLQGSGKTTTCT
KFAYHYMRKGWRVGLVCADTFRAGAFEQLKMNAAKIKCPFFGHKKETDPVKIAQEGVNFF
KEQKFEIIIVDTSGRHKQEAALFEEMQQVQAAVSPDTSIFVMDSSIGQACYDQATAFNKA
IRVGSVIITKLDGHAKGGGALSAVSATQSPVVFIGTGEHFDDLESFNASSFIKRLLGLGD
IGGLVQTVKDAIPEDKQKKMVENIQKGEFSLRDMRDQFASVLNMGPLNQVVSMIPGLSSN
LIPKGREKESTARIKRFLCIMDSMTDEELDCIKPMSDFRILRIAKGSGCRPEEVAFLLEE
HKKFAKMVEQFGKMKLNNQTDLKNLNRNPKQLMQQMSKAIDPKLLQQMGGMGNLMNMMKE
MGNMEGMQDMMSSMMGGGAGGAGGAPGGLGGLGGLASALGGGGGMPDLSALAGALGRGGG
GMGMPPGMGGMRRGGGGGRRR