Identifiers and Description

Gene Model Identifier

Contig18914.0.g46

Standard Name

SRP40

Aliases

Contig18914_0_g46

Description

SRP40, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011239700.000009999254677478949SRP40, C-terminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18914.0.g46(coding)
ATGAAGATTGAAGCAGAAGACTTGTGGCCACTAGTTTTGGATTTCATAGAGACCTACTTC
GAGGAGGATGATGTGCAACTCTTCAAGAAACATTTCAGTCTCAAGATTAAGCACAAGAAT
GATCCAATTGTCAAGGCTGGTGGTATTTAAGCATTACTAGGTTGTTATTTGAAGCACAAC
AAAGATGTATACAAGGCTTTTAAGAAGCACTTGAAGAACAAAAAGAAAGCTCAAGAATCA
TCTGATGAAGAAGAGAGTGACAGTGATGATTCAGATAATGACAAGAAGAAAAAGAAGTCA
AAGAAATAGGAGAATGGTAAGAGCAATGGCAAATTAGCAGGTTAAAAGAGATCAAAGAAG
GACGAATCAAGTGAAGATGAGAGCAGTGAAGAAGATAGTGATGATGATAAGAAGACTGCC
AAGAAGAACGGAAAGGTTAATAAAAGACAAAGAACATCCAGCAATGCATCAAGAGCTAGA
TCTTCATCTAATGATTCCTCAGCTTCATCCGTCAAGAAACCTGCCCCAATAAGAAGAATG
ATTGCCTCTAGAACCAGAAAGAGATCTGAATCAGTGGCTAGTGACTACGTTCCACCCATT
AAGGATCCAAAGGCTGAGTCACTTAAGATGAACATTAACGTTAAATTCCAGAGAGTTAAT
GAGGAGAAATATGCAACTATGCTTAATGAAGTAACCACAGATAATACCTTCGAGAGTAAA
GCCAGATTTGGCATGGGTGGAGGAGACAAATTCGGTGAGTGGTCAAATGTGATGCTAAGA
GACAAGGTCGGCAAAGGATTCATTAAGGAGAAGAACAAGATGAAGAATAGAAACTTCCAC
TCATAGGGAGAGAGAATCGGCTATGGAATCAACTCAGTCAAATTCGATTGA


>Contig18914.0.g46(protein)
MKIEAEDLWPLVLDFIETYFEEDDVQLFKKHFSLKIKHKNDPIVKAGGIQALLGCYLKHN
KDVYKAFKKHLKNKKKAQESSDEEESDSDDSDNDKKKKKSKKQENGKSNGKLAGQKRSKK
DESSEDESSEEDSDDDKKTAKKNGKVNKRQRTSSNASRARSSSNDSSASSVKKPAPIRRM
IASRTRKRSESVASDYVPPIKDPKAESLKMNINVKFQRVNEEKYATMLNEVTTDNTFESK
ARFGMGGGDKFGEWSNVMLRDKVGKGFIKEKNKMKNRNFHSQGERIGYGINSVKFD