Identifiers and Description

Gene Model Identifier

Contig20678.0.g40

Standard Name

SRP19

Aliases

Contig20678_0_g40

Description

SRP19 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • SRP-dependent cotranslational protein targeting to membrane (IEA) | GO:0006614

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002985302.9992476920535046e-16SRP19 protein
SGDYML105C0.0000000000002999981760818895SEC65 SGDID:S000004573, Chr XI
II from 58687-57866, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20678.0.g40(coding)
ATGAGTGAGGAAGAATAAAAAGGTCCACAAATGAATCCAGGTTAAGGCTTGCCTCCAGGT
ATGGTATTACCTCCAGGCATGTAACTTCCACCAGGCATGTAGCTCCCACCAGGGATGCAA
TTGCCACCAGGAATGCAGATGCCCCCAGGTATGTAAATGCCCCCAGGTATGTAAATGCCC
CCAGGCATGCATGGTCAACCAGGACAACCACAATTCTAAACTCTCGACCCAGAAGTCTAT
AAGAATTGGATATGTGTATATCCATGCTACTTCAACTCTAATAAATCAGTAGCTGAAGGT
AGAAGAGTCACCAAAGCAAGAGCTGTGCCTAATCCTTAAATGCCAGAACTGTCACATATT
TTGTAATTTGTTAGAGTCAAGCATGTCATTGAACCACAAAGAATGCACCCCAAAGATTGG
TAACATCCAGGAAGAATCAAGATTTGCTTATTTGACGAACTTGGAAACACAATTCACCCT
AAAATTACCTCAAAGAAACTTTTGTTTGATTGCATTTGCGACTTGCTTCCACAACACAAA
GCCAGACAAGAAGCTCCTCCTAAGGCATTAATAGAACAAAAAAGAGCAGAATTCATCGCA
GCTCAAAAGAAAGATAGATTAGAGAGACAGAGAGAGTTTAATAAAAAGGGAATCCGCACC
ACAAAGAGAAAGCCAAAGCCTCAGGAATGA


>Contig20678.0.g40(protein)
MSEEEQKGPQMNPGQGLPPGMVLPPGMQLPPGMQLPPGMQLPPGMQMPPGMQMPPGMQMP
PGMHGQPGQPQFQTLDPEVYKNWICVYPCYFNSNKSVAEGRRVTKARAVPNPQMPELSHI
LQFVRVKHVIEPQRMHPKDWQHPGRIKICLFDELGNTIHPKITSKKLLFDCICDLLPQHK
ARQEAPPKALIEQKRAEFIAAQKKDRLERQREFNKKGIRTTKRKPKPQE