Identifiers and Description

Gene Model Identifier

Contig2103.0.g7

Standard Name

SRP101

Aliases

Contig2103_0_g7

Description

SRP54-type protein, GTPase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00448 ) SRP54-type protein, GTPase domain
  • ( pfam04086 ) Signal recognition particle, alpha subunit, N-terminal
  • ( pfam02881 ) SRP54-type protein, helical bundle domain
  • ( pfam13401 ) AAA domain
  • ( pfam03308 ) ArgK protein
  • ( pfam13191 ) AAA ATPase domain
  • ( pfam01656 ) CobQ/CobB/MinD/ParA nucleotide binding domain
  • ( pfam13380 ) CoA binding domain
  • ( pfam10236 ) Mitochondrial ribosomal death-associated protein 3
  • ( pfam08314 ) Secretory pathway protein Sec39
  • ( pfam03266 ) NTPase
  • ( pfam03205 ) Molybdopterin guanine dinucleotide synthesis protein B
  • ( pfam13604 ) AAA domain
  • ( pfam13555 ) P-loop containing region of AAA domain
  • ( pfam01012 ) Electron transfer flavoprotein domain
  • ( pfam02590 ) Predicted SPOUT methyltransferase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001852003.000742025943196e-157SRP54-type protein, GTPase dom
ain containing ...
SGDYDR292C6.001629673589058e-65SRP101 SGDID:S000002700, Chr I
V from 1045011-1043146, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2103.0.g7(coding)
ATGTTTGACTTCGTATGCATTTTCACAACCGGTGGAGTAGTTCTCTGGTGCAAAGCCTTC
CAAGAGATGAAACTAGACCTCCTGAACATCTTCATTCAGAGAATATTACTTGAGGAGAAA
TCTAATAACACTCAATTCAATTTTGCTGAGTTCGTGCTCAAGTGGAAAGTACAAAATGAT
CTTAATCTCGTATTCGCTATCATCTACAAGGAGATATTGCAATTACAATTCGTTGAAGAC
CTCCTAGATTTAGTGCGCTATGAATTTGTTACCAAAATCTACCCTTAAATTCAAAAGCAA
GGTGAGGTATACCTTGATCTCCCAACTAATTTCGATGGTCACTTTTAAGTTTTGTGGAAA
AGATGGGAGCAGAAAACTAAGGAGCTTGAAGGGCCAAAATAAATGAAAAGATTCGACTAG
ACATCTAAAGCCAAGAAACTCAAGGAGAAATCTGGCATAATCAATAAAAATGATTTCTCA
AGAAGTTCGACAAACGAAGCTCGAGAAGCTCTAAAGAACAAGTTCAACAAGTCACATACA
GTGACTGAACGCAAGAGCACTTCCACTATTCTAGGATCCGAATCAACAAAGGCAGTTAAC
TCAGGAGGCAAAGAGATGAGAAACTGGATGGGAGTTAGTGACAAAGTGTCAGCCAAGTAA
TTAGAGCAGATTGATGTCAGTTTGAACAAAGGGGGAGAGATAGACATCGATAGGTAGAAG
GAAATATACCTGGGAGGGGATGACGACGAGCTAGAAGGATTCTATAATTCAGATGATGAG
ATAGATTTTGAGAATTTCAAGAGAGGAAATAAAGGTTAAAAGCAGGGCGGTGGTTTGTTC
TCAAAGCTTACTAATGCCTTCCAAAATATCACTGGAAACAAAACTCTATCAGAAGAGGAT
GTAGAGCCTATTCTCAAGTCCTTCTCTGATGCTCTCATTGAGAAAAATGTGGCATCAGAA
ATCGCAGAGGCATTGTGCAAAAGTGTTGCCAATACATTGGTAGACAAACGCACTGAATCA
TTCACTACAGTTAAGGCCACAGTGAAATAAGCTTTAATCGATTCAATTACTAAGCTCCTT
ACTCCCAAGAGAAACATCGATATTTTGAAGGATGCTCTCTCTGCAAAGCAGAAGGGTCAG
GTTTACTCATTAGTGTTCATTGGTGTAAACGGAGTTGGCAAGAGTACCTCCCTGGCTAAG
GTAGCTTACTATTTGAAAACTAAGGGCAACTTGAAAGTAATGATGGCAGGGTGTGATAAC
TTCAGATCTGGAGCCATCGAGCAACTCAAGACTCATTGTTTGTGCTTAGACTGCCCTATC
TATGAGAAGGGTTATAAAGATGATCCAGCTATTATCGCCAAAGAAGCATTACAAGAAGCT
AAAACCAAGGGTTATGATGTTGTTTTGATTGATACTGCTGGTCGTATGCAAGGAAACGAG
AAGTTAATGAGACAACTAGCAAAATTAGTCCACATTAATAATCCAGATGTAGTCCTCTTT
GTTGGTGAAGCACTCGTTGGAAACGATGCTATAGATCAATTAACCAAATTCAACCAATCA
TTGATTGACTACGCAGTTTAAGACACAAACCCACGCACAATTGATGGCATTATCATGACA
AAGTTTGACACAGTTGATGAAAAAGTAGGCACTGCCCTGAACATGGTGTATACTACTGGT
AAACCTATTGTTTTCGTAGGTATTGGACAAAAGTACCCTCACTTAAAGAAACTTAACGTG
CAAACTGTCATTGGTGCATTAATGAGCTGA


>Contig2103.0.g7(protein)
MFDFVCIFTTGGVVLWCKAFQEMKLDLLNIFIQRILLEEKSNNTQFNFAEFVLKWKVQND
LNLVFAIIYKEILQLQFVEDLLDLVRYEFVTKIYPQIQKQGEVYLDLPTNFDGHFQVLWK
RWEQKTKELEGPKQMKRFDQTSKAKKLKEKSGIINKNDFSRSSTNEAREALKNKFNKSHT
VTERKSTSTILGSESTKAVNSGGKEMRNWMGVSDKVSAKQLEQIDVSLNKGGEIDIDRQK
EIYLGGDDDELEGFYNSDDEIDFENFKRGNKGQKQGGGLFSKLTNAFQNITGNKTLSEED
VEPILKSFSDALIEKNVASEIAEALCKSVANTLVDKRTESFTTVKATVKQALIDSITKLL
TPKRNIDILKDALSAKQKGQVYSLVFIGVNGVGKSTSLAKVAYYLKTKGNLKVMMAGCDN
FRSGAIEQLKTHCLCLDCPIYEKGYKDDPAIIAKEALQEAKTKGYDVVLIDTAGRMQGNE
KLMRQLAKLVHINNPDVVLFVGEALVGNDAIDQLTKFNQSLIDYAVQDTNPRTIDGIIMT
KFDTVDEKVGTALNMVYTTGKPIVFVGIGQKYPHLKKLNVQTVIGALMS