Identifiers and Description

Gene Model Identifier

Contig366.1.g36

Standard Name

SREK1IP1

Aliases

Contig366_1_g36

Description

Zinc knuckle

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • integral component of endoplasmic reticulum membrane (IEA) | GO:0030176

Molecular Function

Biological Process

Domains

  • ( pfam13917 ) Zinc knuckle
  • ( pfam10310 ) Protein of unknown function (DUF2413)
  • ( pfam02737 ) 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
  • ( pfam10359 ) RNA pol II promoter Fmp27 protein domain
  • ( pfam08840 ) BAAT / Acyl-CoA thioester hydrolase C terminal
  • ( pfam11262 ) Transcription factor/nuclear export subunit protein 2
  • ( pfam05549 ) Allexivirus 40kDa protein
  • ( pfam06936 ) Selenoprotein S (SelS)
  • ( pfam14392 ) Zinc knuckle
  • ( pfam12467 ) Cucumber mosaic virus 1a protein
  • ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002945500.0004999512321494991hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig366.1.g36(coding)
ATGATCACAGGCTGTCGAAAATGCGGCCTCCTCGGCCACTTGACATCTTAATGTATGAAC
GTTTTAAAAGATAAGCACGGTAATGAAGTCAGACTAGTAGATCCAAAATAACTCTAGCAA
CAGCTAAACAGCGAGGGAATGAGAGACATAGAGAGAGAAGTGGAAGTTAACGATAAAATG
TTGGAGAAACTAAAGAAAGCCATTAAGAAAAACAAAGAGAAGAAGAAGGAGAAGAAGAAA
GAGAAGAAACACAAGGAAAAGGAGAGAATTGAACAGATTAAAGTGGAGTTGGGGTTAAAG
AAAGGCAAGAAAGATAAGAAGAAGAAAAGCAAGAAAAGTGACAAGAAAAGCAGTAAGAAA
CATAGGAAAGCGAGTAGTGAGAGTGATGACAGTGATAACTCATCTGTTTCTTCTGAGTCT
GATAGTGATTGA


>Contig366.1.g36(protein)
MITGCRKCGLLGHLTSQCMNVLKDKHGNEVRLVDPKQLQQQLNSEGMRDIEREVEVNDKM
LEKLKKAIKKNKEKKKEKKKEKKHKEKERIEQIKVELGLKKGKKDKKKKSKKSDKKSSKK
HRKASSESDDSDNSSVSSESDSD