Identifiers and Description

Gene Model Identifier

Contig826.1.g130

Standard Name

SRCAP

Aliases

Contig826_1_g130

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00176 ) SNF2 family N-terminal domain
  • ( pfam00271 ) Helicase conserved C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_015468601.000008670162283e-147SNF2 family N-terminal domain
containing protein
SGDYDR334W9.997217559668329e-127SWR1 SGDID:S000002742, Chr IV
from 1135932-1140476, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig826.1.g130(coding)
ATGGAAAATTAGAAAGGACTCTAGCAACAACTTATTTTGCGCAAGAGAGACATCAAAGGC
AATTACAAAGCAAAATTCAACATTGAGAAGTTGATGATTGAACATGAACGAAAAAAAATT
TAACTTCAGGAGTTGAATGATAAATACGAAGAAATCTAAGATTAGATGAATGATTTGAGA
TCCAATATAGGAAAGAAAGTGCAGTCAGGGGAAATTTTGGATGGGAAAACTCAATCATCA
AAATGTCATTGGGGTTTTCTCTAAAAAGAAATGAAATGGATGGCTGAAGATTTTGAAAGA
GAGACCAAGAAAAAGATCACAGACTCTAAAAAGCATGCTAGGTCTTGTAAGAAAGAGCTG
CATGAAAAGAAACTCAGGAAGGAAAAGGACATCAAAGATCAAAAGATTGAGCTTAGGAAA
AAAGCGGTAAATATGGGAAGGATGGTTGGCCAGTTCTGGAAATCCATTGAGAAAGTTGTG
AAGCATAACTATAATGTGCTTTATGAGAAAAAGCGTTAACAAATCAGAACTAAGAAGCTT
GAGAACTTCGTTAGTAAGCATTTGAAGCTCAGTGTCAAAGTAGCTGAAGAGCTAAACACA
AAAGCATTCGTAGACTAAAGTATGTACAACAAAGATGGAAATTTAATTGAAAATAGGGAG
AATTAAGCCCCAAACTAAGGCTAAGTAATAGTCAAGATCTATGGCTCGTAAGACGAAATT
GATCATTAGAAAAATGTAGAAATGCTGAATGATATAAGTAATCAATAGGATGTTTAACTT
CAACCTTACAAGAGATAAAAGATAAGTGTGATTGTACAGAAAGATCCTGAGGGAGGGTAT
TCTTATGATCATGAAATAATTCACAATGATAATCAGACTCTAAACACTGGACAATCTTAA
GCCAATGAAAATGATGAAAATGCAAGAGCTAGAATTGCTGAATAAACAGTTGAAATGGCT
AAAGCTCTATAACCTCAAGGTTTTACTTTATCTTCTGTCAATGTAAAAACAAAAGTTCCA
TTCTTGCTTACTGGAGAACTTAGAGAATATTAAATTATTGGTCTAGATTGGATGGTTACT
CTTCATAACAAGAAGCTTAATGGAATATTGGCTGATGAAATGGGATTAGGTAAAACTATA
CAAACAATAGCTTTGCTTGCTTCTCTTGCTTGTGATAAAGGCGTTTGGGGTCCTCATCTT
ATCGTCGTACCAACAACTATCATTATTAATTGGGAAATGGAATTCAAGAAATGGGCTCCT
GGTTTCAAAATTTTGACATATTTTGGTTCATAAAAGGAAAGAAAAATGAAAAGACATGGT
TGGAGTAAAGAAAACTCTTTCCATGTTTGTATAACATCTTATAAGCTAGTCATTTAAGAT
CATTTTGCTTTTAGAAGAAAGAAATGGTACTATATGATTTTAGATGAGGCTCAAAACATT
AAGAATTTTAAAAGTTAGAGATGGTAGACATTATTGAGATTCAATACAAAAAGAAGACTC
CTGCTTACTGGAACTCCACTATAAAATGATGTAATGGAACTTTGGTCTCTTATGCATTTC
TTAATGCCAACAATCTTTAGCAGTTAACAAGATTTTAAAGAATGGTTCTCAAACCCATTC
AGTTAATCAATCAATCATAATTAAAGCTTAAATATATCTGTCGTCCAAAAGCTTTAAAGC
ATATTAAGACCATTCTTGCTGAGAAGAATGAAGAGAGATGTTGAAAAGTAGCTTCCAGAA
AAGATTGAACATATTGTTTAATGTAATCTTTCAAGAAGATAAAGGCTACTGTATGATGAG
TACATTAACTCTGATAAAACTAAGCAGACACTTTAAGATTCAGATTTCTTCAGTATTATG
AATGTGCTTATGTAGTTAAGAAAAGTATGTAATCATCCTGACTTATTTGAACCTAGATCT
ATTGAATCGCCTTTTATTATGCAAGATAGATTGAAATTTAACTTCAGTACATTGATTTAC
AAAGCCTTCCAAAACAATCCCTTAAAAGATGTGAATTTACAGAGTCTCAGCTTTGTTCTA
ACTGAGTTTGAATCAATTTCTAGAACAGAATATTAATCATTATAGGAGCTTTACCCCAAA
AGACCTCTAATTCAAGTAATAGGAGAGAATTAAAACCACATCGATGATTTATCTCATCAC
TTAATGCAATCGAGACCTTCCGCAGATGGTTATTCTTATGGAAGAAAACTCCCAATAAAT
TGTAATGTACTTGCTAGATCAAATACCAAAAGTTTAAAAAATACTCTCACATAGGTTCTT
CCCTATGAAACAAACATTTATCATGATGTACCAAGCTACCTGAACACTGCTAGTTTGCCT
TTTACTTAAAACTACTACTCTCTAGATAACTTTGATTTCATGAGGTATTCTTAAAGAACT
AAAGAGTACAATGAATATGATTATTACATGAGCGCTTTGCACAATGATGAGCAAAGACTT
CATCTAATAAGATTCGCTAACAAATTAATATAATGGAAACAAATTGACTCTACTAATAGA
AACAATTTGATGTTTAAGAAACCAGTCTATGGGGAAGATTGTAGAAAAGCAGTTAAAATA
AATCTCCTTTTTGGCGATGTATTTGAAGTTAAAAGACATAAAAACTTAGATAGATATAAC
AAAAAGGACATCACCTCTATTAATGATCTCGATAGAGCTTCCTCAACAATATTTAATCCT
TTCTCTCAAAATCTAGTATTTAACTCAGATTAAAGAGATGAACTCAATCATAATCTTGTC
GAAGATTGGCCAGAGTAAACAGAAGAATAAATCGAAGATTATAACATCTAAAATCCTTTA
ATTAAGGAGGTACCTCTTAGCCAGTAATTAACAAATAAAAATAGAAAGAAGTAAATCAAA
GAACAACTAAAAAAAGAGCAGGAAGAATAGCAAAGAAGGCTTCAAGAACAATTATAAATT
CAGTTATAGGAGAGATAGAGAGAACTCGCACTGTAATAATAACAGGACTAGATTATGAAT
GAAGATCAAGAAATGGAGGAAGTTGAAGTTGAATAGACAAAAATAGAGAAAATTAAGATG
TTTAGCTTGGTCATTGACATGAAGGCAATTAATTAGGAGATACTTCAATAAGAAAGTATG
GAATAATAAATGGAGGTGGACTAACAAGAATAGGAAACGGTTTTAGATCAGGAAATATTC
ATAAATCCAAACGTTTAAGTGGTCATTGATGAAATGGAACAAGAAGTGACTGAAATTAAA
ACAATCAAAGTGCCAAAATAGATTCAAACAGTTAAAAACTAATTAGCCTAAGATTAAGTA
GTCTCTGAAGAAAAGTTAAAAATTTTAAGTCCAAAATATTAACACGAAAATGGATACCAG
GCTTAAGAAAAAGAATTACAAGAATTCTAAAGTCCAGATCGTAAATCAACATAAGAGAAT
GCACTGGTTTAAGAAGAGGATAAAAAAATGGAAGAAGTCAACCAAAATAATTCAGATCCT
TATTCAGGCTAATCCACAAATCTTCCAGCTTAATAAAATGATGTACAATTAAATAGTCAA
GAATAGCTAGAATAAACTCAAAAACAGCAGTCCGCAGCTAAGGATCAAAACACTTCCTCT
TAGAAAGAGCAAGAGAATTCTCAAATTTAAGTACCATAGGAATAATAGCAATAACCATCA
AAGAAAGTTGAATAAGTATAAAATTAACAATTCACCTATAAAAATTGTGAAGTGTTAAGA
GAAATGATTGTAACACCATTACAAAGAGTTTAAATTTTAGAGGAAACAATCAGACATTAC
AAGTTTATTATTCCAAAAGTAGTTGCAAATACAGTAGACTTTGTTCCTTCTAAGATTGTT
ACTTAACATCAAAAGGAGAAAGCTTATGAAAGATTCTTGTATTAAAAGCTGATGTCTCAT
AGAAACGTTAATCAGTCTTTAAAATTCTCAAACATCCTTTTCTTCCCTCATAAGAACTTA
ATTCAATACGATTGTGGTAAACTATAGAGATTAGCTATGTTACTTAAGAATCTTCACTCC
AAAGGTCACAAAGTTTTGATTTTCACACAAATGACAAGGATTTTAGATATTCTCGAGCAG
TTTTTGAATCTCCACGGATATTCCTATGTGAGACTAGATGGTTCTGTAAAGGTAGAGATG
CGTCAAAGACTTGTTGATAAGTTTAACTTAAACAAGAAAATCTTTTGCTTCATTTCATCA
ACCAGATGTGGTGGAATCGGCATCAATTTAACTGGAGCTGACTGTGTCATTTTTTATGAT
ACCGATTGGAATCCAGCCATGGACAAGCAAGCTTAAGATAGATGCCATCGTATAGGCCAG
ACTAAGACTGTCCATATATATAGGCTAATCTCAGTCAATACTATTGAAGAGAATATCTTT
AAGAAGAGTTTGCAGAAGAGAGATTTCGGTGGACTCATTATAGAGGGTGGATTTGATATG
GATTTCTTCAAGAAAGTATCTCTTAAGGATATCTTGGAAGACGATGATTTCTTAAAGCCA
AAGCGCAGAAACCTTATGAAAGAGGAAAATATCGTGTTTCATAGTAACTACCAAAATTTA
GGACTTGAAAACGGAGAAGAGCAAGAAGTAGTGAATGAGCTAGATTTCGAGAAGCAAAGA
GAGATGGAACAATATAGAAGAAAATTCGAAGAAGCACTTGTTAGAATAGAGGATAAGGAG
GATGTTATCGCATTTTAACAGGCTAAGAGAGAAATAGATGATGAATTTGATGAAGATGCT
ATATTAGCTCAAGATGCCTCTTCTACAGTAGGAACTGTAAGTAAAATTGGAGATTAAGAG
AAAAATTAAGCAAGCGTTGATGGCTAACTTCCTGAAGACGGCTAAGAAGAGGATGTAAAT
GAATAAGCTCCAGCCTTTGATAACAAGGGCGCTTCTCAGCTCCAGAGTGAAATGAAAAAG
AACGAGTTTATCAATTGGAGAAACCATCCAACCCTTAATGAAGTGACTAAGATGTGCATT
GAGTATTTAGAGAACGGGTTCTCCTTCGATTAATACCTCGATGACAGAGCCAAAAAGGAT
GCCAAATTCGTTAATCCACTTAAAGACGAGAAAGAAATTGAAGAAGAAAAGAAAGACCAC
AAAAATGGCGACTAGGATGGTGGCAGTGAATTCAGCTTCTCAGAGGATGATGAGTAGATG
TCACAGAATGAGGAGCAAGGTTAAGAAGAACAGTATGATAGAGCTGTAGCTGATGCCCTA
TATAAGCGCACAAGACATGAAATTGAATAAAATTACTTTATTGTTTGA


>Contig826.1.g130(protein)
MENQKGLQQQLILRKRDIKGNYKAKFNIEKLMIEHERKKIQLQELNDKYEEIQDQMNDLR
SNIGKKVQSGEILDGKTQSSKCHWGFLQKEMKWMAEDFERETKKKITDSKKHARSCKKEL
HEKKLRKEKDIKDQKIELRKKAVNMGRMVGQFWKSIEKVVKHNYNVLYEKKRQQIRTKKL
ENFVSKHLKLSVKVAEELNTKAFVDQSMYNKDGNLIENRENQAPNQGQVIVKIYGSQDEI
DHQKNVEMLNDISNQQDVQLQPYKRQKISVIVQKDPEGGYSYDHEIIHNDNQTLNTGQSQ
ANENDENARARIAEQTVEMAKALQPQGFTLSSVNVKTKVPFLLTGELREYQIIGLDWMVT
LHNKKLNGILADEMGLGKTIQTIALLASLACDKGVWGPHLIVVPTTIIINWEMEFKKWAP
GFKILTYFGSQKERKMKRHGWSKENSFHVCITSYKLVIQDHFAFRRKKWYYMILDEAQNI
KNFKSQRWQTLLRFNTKRRLLLTGTPLQNDVMELWSLMHFLMPTIFSSQQDFKEWFSNPF
SQSINHNQSLNISVVQKLQSILRPFLLRRMKRDVEKQLPEKIEHIVQCNLSRRQRLLYDE
YINSDKTKQTLQDSDFFSIMNVLMQLRKVCNHPDLFEPRSIESPFIMQDRLKFNFSTLIY
KAFQNNPLKDVNLQSLSFVLTEFESISRTEYQSLQELYPKRPLIQVIGENQNHIDDLSHH
LMQSRPSADGYSYGRKLPINCNVLARSNTKSLKNTLTQVLPYETNIYHDVPSYLNTASLP
FTQNYYSLDNFDFMRYSQRTKEYNEYDYYMSALHNDEQRLHLIRFANKLIQWKQIDSTNR
NNLMFKKPVYGEDCRKAVKINLLFGDVFEVKRHKNLDRYNKKDITSINDLDRASSTIFNP
FSQNLVFNSDQRDELNHNLVEDWPEQTEEQIEDYNIQNPLIKEVPLSQQLTNKNRKKQIK
EQLKKEQEEQQRRLQEQLQIQLQERQRELALQQQQDQIMNEDQEMEEVEVEQTKIEKIKM
FSLVIDMKAINQEILQQESMEQQMEVDQQEQETVLDQEIFINPNVQVVIDEMEQEVTEIK
TIKVPKQIQTVKNQLAQDQVVSEEKLKILSPKYQHENGYQAQEKELQEFQSPDRKSTQEN
ALVQEEDKKMEEVNQNNSDPYSGQSTNLPAQQNDVQLNSQEQLEQTQKQQSAAKDQNTSS
QKEQENSQIQVPQEQQQQPSKKVEQVQNQQFTYKNCEVLREMIVTPLQRVQILEETIRHY
KFIIPKVVANTVDFVPSKIVTQHQKEKAYERFLYQKLMSHRNVNQSLKFSNILFFPHKNL
IQYDCGKLQRLAMLLKNLHSKGHKVLIFTQMTRILDILEQFLNLHGYSYVRLDGSVKVEM
RQRLVDKFNLNKKIFCFISSTRCGGIGINLTGADCVIFYDTDWNPAMDKQAQDRCHRIGQ
TKTVHIYRLISVNTIEENIFKKSLQKRDFGGLIIEGGFDMDFFKKVSLKDILEDDDFLKP
KRRNLMKEENIVFHSNYQNLGLENGEEQEVVNELDFEKQREMEQYRRKFEEALVRIEDKE
DVIAFQQAKREIDDEFDEDAILAQDASSTVGTVSKIGDQEKNQASVDGQLPEDGQEEDVN
EQAPAFDNKGASQLQSEMKKNEFINWRNHPTLNEVTKMCIEYLENGFSFDQYLDDRAKKD
AKFVNPLKDEKEIEEEKKDHKNGDQDGGSEFSFSEDDEQMSQNEEQGQEEQYDRAVADAL
YKRTRHEIEQNYFIV