Identifiers and Description

Gene Model Identifier

Contig16618.0.1.g58

Standard Name

SPT6

Aliases

Contig16618_0_1_g58

Description

Zinc knuckle

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010935502.000234809436283e-103Zinc knuckle family protein
SGDYGR116W9.999888128184441e-42SPT6 SGDID:S000003348, Chr VII
from 720409-724764, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16618.0.1.g58(coding)
ATGTAGAAGGGAAAGAGAGATTAAAGTGATTCTAAGTCATCAGTATCCAAGGGGGATGCA
GACATGGCAGAGGGCGATTAAGAAGGCCAAGACGACTAAGACTCCGATGGAGACGATGAC
GAAGACGATGAATACGATGATGAAGTAGACGAAGAACTTGAAGGATTCATCGCTCCAGAT
GAAGATGTGGAGAGAGAAATTCAGGAGGAGTAGGAGCAGCTGCGCAGAGAGTATAAGAAA
AGCGAGAAAAGAAAGCATAGGAGAAGATAAGAACCTCAACTTGAGCAGGACGATTTTGAC
CTCATCGAGGAAAACATCGGTGTCCCTGTGCAAAAGAAGCGCAGACTGCAAAAGAACATT
GAGCATTTAGAATCTCCTCACCAACAATCTGAAGAGGATCGAGATGTCGGCAAAGCCAGA
GATATTGACAGAGAAGGCAGGAGGAGAGTTGACCTGTAAGATCTAGATATGAGCGACCAA
GATGAGCAAATCAACACCTCAACTCAAAATAGATAGCAGAAATCAAGAGTTTAAGTGAAG
GAAAGACCAACTTATGATGCTGGATAAGACTCATAAATTGATCATGATAGAGCTGCTGCT
GCTAGACACATTTTCGAGGATCCTACTGTGTTGAAGGAGAAAGTGGCTTTGGCCTAAAAG
ATCAAGGAACAAGAGAAGAAGTTTGAGCAATAGAAAGGTATCCTTGAAGAACTTTTTGAT
GGGGATGAGATTGATGACTAATTTGCAACAAAGCAGGATAAAGCTATTGCCCAAGAAGAT
GTTCCTGAGAGACTCTAAATTAAAGTTGGAGAACGTTTGAGATATAAAATGTAGCCAGAA
GTATTCGAAAATGATATAGCTAATGAAATCGGTTGGATCTATCAAAGACTCCTTGATGAA
TCTAAGAGAGACACACTCCTACACAATGAACTTCCTGCTAAGAGAAAGATTGAGAAAGTT
CTGAGAAACATCAGACTTGAGTACATGGATGTCCCATATATAGCCAAGTACAGAAAGTTT
GAGTATATGAAGGAACTTAACGAGGAAGATATCTGGTCCATCTTCAATTTAGACATCGAG
TATGGAAGATTCTAGAACCAGCTGGAGCTAATGAAAGAACAACTCAGAAAACTCTCTCTT
ATTGAACCCAGACTCTAAGACTATCTTGGTCAAATTGAAACAGTAAAAGACCAAAAGCAA
TTACAGAATTTTTCTCCCTTAATTGCCTTCCTTAAGTCTTACTACTATGAAGAACTCCAG
AGTATGCCTGATGAGAAGACAAAGAAACTTCCATACAAGCAAGATAACGTTATTCAAATC
AGAAGGTACAGACTAGATCAATGCGCTCGTAGGGTTTTCTTGGATCCCATGCTATTTGTA
GAGAATCTCATGAATAACTCCTTCATGCATGTTCATCCTATTCCAAACTAGAACATCAAT
GAAGTTCTATAACCCTACTTATGTGAAGCTTATTCAACCTGGGATATTTGCCTACAAGCC
ATTCTGAGATTTTAATCCTAGCAATTGTCTGTTCAGCCTTATATAAGATCATAAATGAAG
AAACACATGTACAACGTTGGAACTATCAGCACAGAGCCATCAGAACAGGGCAAGAAGGAT
CTTGATCCCTTCCACCCAAGTTACAGAGTGAAGAGAATAAAGAGTGAGCCATTGAACAAT
TTGATCAACAATGAAGGACTCCAAGATTTGTTCCTCGATATAACTTAAAATGAAAAAAGT
GGTTTGATCAAGGTGGCCTTCCACTATGACAGTCAATTAATGCAAAACTTCTCAGATGAA
CTTGCTAGATTTTACGTCTCTCATGACTATACTGAAAATTACATTAAGATCTACAAGGAA
TCTATAAGATCTGCCATCATGGACACTCTTATAGATGAAATCACGAAAGAGATCAGAGAG
GAACTTAAACAAAATGCTGAAAACTTTGTGATTAAGAATTGCCAAGCCAGATACAAAAAT
CTTTTGATGACTGGACCTTTCTCTACTGAGGACCAAAATAAGAGAAGTGAAAGAGATGAG
TATGCTGGATCAAGTAAAACAAGAAGAGATGATGACCCAAACGTTGTCATTCCAGACAGA
CCTAGATGTACAGTTATGGGAGTCATTTTGCAGCAAATTGATTCAAACAATCAGCTTGTT
TCCTTAGCTATTGTTGACAAGTATGGAGAGCTTGTGGCTCACAAAGATCTACAACATTTA
ATGCCACCCAGAAAATTCAACATGGCTCCTGGTTAAAATGCAACAGACGATGAGGATTAA
AGATACAAAAAAGCTAAGCTCTAGCATTCCGAAGAGGTTAAGGAGCACGAGTCTGACAAA
GACAAGATAAAAGATCTTATTCTGAAGCATTAAGTTGACTTGATTGTTGTAGGTGCTAAC
AAACTTGGAGCAAGAACCATCAAGAAAGTCTTATCAGAGATTGCAGAAGGCATCAAATAA
TTTGGCAGTGGACAGCTCTCATCTATGGATTTCGATGATAGAAGAGGAAGTAAGAACAGA
AAAGGAGGTGATACTATGGAAGACTACAGAAAAGAGGCTTTTGTCATTTGGGGTAGTCTA
GAAATCCCTAAGCTTTTCTCTAATAGTCATCAAAGCCAGAAGCTATTGAAGGGTTGCCAC
CCAGTTTTAAAGCAGGCAGTAAGTCTAGCCAGATACGAATAAGACCCCATGAATGAAGTG
TTGAACTTGTGGAGTTTCGTCCCTTCTGAAAATCAAACACTTCAGATTGACTTACATCCA
CTCTAAAAACTAATTAATTAGGCCAAGTTATCTGATTCTCTTGAAGAAATAAATATTCAA
TGTGTTAATGCTGTTGGAATCGATTTGAATTTACTGATTGATCATGATCATATGCATATA
CTTTTAAGCTTTATTTCATGCTTTGGACCTAGAAAAGCTAAATAATTCATACAAGACTTG
AAATCAAGAGGTAACAAGATTCTCAGAAGAAGTGACTTGTACAATTCAAAGTATATGGGA
AGGCATATGTACCTCTACTCAAGCGCTTTTATGAAAATGAGATTAAACACACAAGATATG
ATGGGAGGAATTCAAAACTAAAGCCAAGAAATTTTAGAGATGACTAGGATTCACCCTGAA
TCATATCTCCTAGCTCACAAAATTGCTAAGGATGTGATCTACTCTGGATAAGATGTGGAC
ATCCTTCATACTCAAAAAGCTCTTGCACACATTATTTAAAATCCTTAAAAACTAAAGGAG
CTTGATTTGAAATTGTACAGTTAAGAGCTAGAGCAGAGTGACTAATAAAACATGTTCACT
TTGGTGGAGTACATCATTGATGAATTGTCAGCTCCCTTCAAAGACCCTCGTGAGTACAGA
ACCCCCACTAAGCAGAACCTCACAAACCAGGAGTTATTCTATATGTTGATTGATGAGTCA
GACAAGACCTTTAAGAAGGGTATTATTGTCACTGCGACTGTAAGCAAAGTCTTTGAAAAT
ATGGTGCTTTGCAGATTAGATAACGGTCTTGATGCTACCATCTAGAAAAATGATTTGGAA
AAGACTGATGATAAGTTGCAGAACCTCATTTAACCTGGTCATGTTATTACAGGTAGAATT
CATGAATTAAAGACTCAGGATGAATAAAGGTTCGGAGTATCACTTAACTGCAAGAAGAAA
GATCTCGAAAGTCATGAAGGGTACATCGACAAGTAACATGTTGCTCCAGAGGACTGGTAA
AATCAAGCATTTGTCACAGACAAGAAAATCCAGTAAGCTGGCAGAATTATCTTCAGAAGA
ATAGCTCATCCCAAGTTCAAGAATATCACTTCTCAAAGAGCTATCTAAGAGCTTCAAGAT
CAAGATATTGGAGAATATATCTTCAGACCTTCTTCAAAGGGAGAGAACAATATCACTTTG
ACTTGGAAGTTCTATCAAAATAACATCGTCCATATTGACATCCCTGAGCATGATAAAGCA
GTTGGAGCTTCAATTGGATCAAAGCTATCAATCAGTGATGAAATATTTGAGAACTTACAA
GAAATCGTGGAGAGATACATAATGCCTTGCAACAAGAACGTGAGAGATGTTTGTTAAAAC
TAGAAATTCCAGCATTTTGAAAACTCAGAAGATCTTGAAAAAGTTCTTAAAGACGAAAAG
ACTGCTGATGCCAACAGAATTCCTTATAAGTTGACTATATTGCCTTAATATCCTCAGCAT
GTAGTTTTGGCATATATTCCAAAGTAGCAAATGATTAAGGAGTATATCAAGGTTAAACCA
AGAGGATTATACTTCCATGATAAGTATCACACTCCCTCTTAAGCCTTGATTAACTGGTTC
AAGATGAACTACAGTTAAAAAGAGTATCTCAAGCAAATGAAAAGAAACAAGAATTCCCCA
AGAGCAAAAATCATAAACACTGACTAAAGTAGAGCATAGGCATCAGGAGGTGCACCTGAA
TTTGGAAGAAACAAGCCAGGAAATGAGTGGAGTGGTGTAAGCAATGAATGGAGAAAATCC
GCACCAAACAGTATTCATTCTATGAATGATGACAACGAGGGAAACACTCAATATGCTGGT
CAAACCAATAGAGGAAATGATCATGGAAGATCAGGCTATAACCCTAGCTACTCTGAATAT
GGATAAAGTGGTGCTGGTAGAGGCGGCGGAGGCTCTGGTTTGTGCTATAATTGTAATGAA
ACTGGACATATGGCAAGAGACTGCCCAACAAAATCACAAAAGTCTTTTGGAAGAGGTAGC
AAAGGAGGCACATCGTATGGTAGAGGTCAAAGAAGAGGAAACGATAATGACAATGACAAC
GGTGGAGGTAACAATGACTACAACAGCAACAGGAGAAATGATACTACTGATAACAACTGG
GGTGCTCCAAGAGATCTACCTCCAGTAACAAACGACAGCGCTGGTGGTTGGAACACTGGA
GCTGGTAATGATCATGAACCAATGCAAGTTGAACCTTCAAACTAAGGATGGGGAGTAACC
AATACTCCAGGTAACTTGCATGCTGCTACTTCATGGGATCCACAGCCTGCTGGTCAAAGC
AACGACTGGGGAACTAGTAATGACAACTAGAATGAAGGTTACTCACCAGCAAGATCAAAC
CGCTCAGATGAGAGAGGTAGAGGCAGAGGAAGAGGTTTCGGAAGAGGAAGAGGAGCACCT
GGTGGTGGTGAATGCTTCAAATGTGGTCAGAGTGGTCACATGGCAAGAGAATGTCCAAAT
CCAGATACTAGACCTCAAGGAGGAAGAGGCAGAGGAGGTCCTGGTGGAGGAAGCAGAGCC
TGCTTCAAATGCAACGAAGAAGGTCACATGGCCAGAGATTGTCCTAACCAAGATCAACGT
GGTGACGATGGTGGACGTGGAAGAGGCAGAGGTAGAGGTCGTGGTGGTGATGATCGTGCA
TGCTTTAAATGCTAGTAGACTGGTCATTAAGCAAGGGATTGCACCAACTAGGATGATGGA
GATAGACAACCCTACAAGAGATATAGAAGAGAAGATGGAGGTTCAGCAAGAAGAGACGAC
AGAGATGACAACAATAACAATGATTGGAGTAGACGCGATAACGATAAAAATGACAACAAT
GGCGGTGGAAGAGACTGGGACAGCAACGACAGAGACAACAAGCAATCCGCAGGGAAGAGT
GACAACTGGGTGAAACCTGCCGACAGCAATTCTCAGCCAAATGATCAATGGGGCAACACA
GGTGGCGACAACAACAATAACAATAACACTAGTAGTTAGGGAGCATGGTAATGA


>Contig16618.0.1.g58(protein)
MQKGKRDQSDSKSSVSKGDADMAEGDQEGQDDQDSDGDDDEDDEYDDEVDEELEGFIAPD
EDVEREIQEEQEQLRREYKKSEKRKHRRRQEPQLEQDDFDLIEENIGVPVQKKRRLQKNI
EHLESPHQQSEEDRDVGKARDIDREGRRRVDLQDLDMSDQDEQINTSTQNRQQKSRVQVK
ERPTYDAGQDSQIDHDRAAAARHIFEDPTVLKEKVALAQKIKEQEKKFEQQKGILEELFD
GDEIDDQFATKQDKAIAQEDVPERLQIKVGERLRYKMQPEVFENDIANEIGWIYQRLLDE
SKRDTLLHNELPAKRKIEKVLRNIRLEYMDVPYIAKYRKFEYMKELNEEDIWSIFNLDIE
YGRFQNQLELMKEQLRKLSLIEPRLQDYLGQIETVKDQKQLQNFSPLIAFLKSYYYEELQ
SMPDEKTKKLPYKQDNVIQIRRYRLDQCARRVFLDPMLFVENLMNNSFMHVHPIPNQNIN
EVLQPYLCEAYSTWDICLQAILRFQSQQLSVQPYIRSQMKKHMYNVGTISTEPSEQGKKD
LDPFHPSYRVKRIKSEPLNNLINNEGLQDLFLDITQNEKSGLIKVAFHYDSQLMQNFSDE
LARFYVSHDYTENYIKIYKESIRSAIMDTLIDEITKEIREELKQNAENFVIKNCQARYKN
LLMTGPFSTEDQNKRSERDEYAGSSKTRRDDDPNVVIPDRPRCTVMGVILQQIDSNNQLV
SLAIVDKYGELVAHKDLQHLMPPRKFNMAPGQNATDDEDQRYKKAKLQHSEEVKEHESDK
DKIKDLILKHQVDLIVVGANKLGARTIKKVLSEIAEGIKQFGSGQLSSMDFDDRRGSKNR
KGGDTMEDYRKEAFVIWGSLEIPKLFSNSHQSQKLLKGCHPVLKQAVSLARYEQDPMNEV
LNLWSFVPSENQTLQIDLHPLQKLINQAKLSDSLEEINIQCVNAVGIDLNLLIDHDHMHI
LLSFISCFGPRKAKQFIQDLKSRGNKILRRSDLYNSKYMGRHMYLYSSAFMKMRLNTQDM
MGGIQNQSQEILEMTRIHPESYLLAHKIAKDVIYSGQDVDILHTQKALAHIIQNPQKLKE
LDLKLYSQELEQSDQQNMFTLVEYIIDELSAPFKDPREYRTPTKQNLTNQELFYMLIDES
DKTFKKGIIVTATVSKVFENMVLCRLDNGLDATIQKNDLEKTDDKLQNLIQPGHVITGRI
HELKTQDEQRFGVSLNCKKKDLESHEGYIDKQHVAPEDWQNQAFVTDKKIQQAGRIIFRR
IAHPKFKNITSQRAIQELQDQDIGEYIFRPSSKGENNITLTWKFYQNNIVHIDIPEHDKA
VGASIGSKLSISDEIFENLQEIVERYIMPCNKNVRDVCQNQKFQHFENSEDLEKVLKDEK
TADANRIPYKLTILPQYPQHVVLAYIPKQQMIKEYIKVKPRGLYFHDKYHTPSQALINWF
KMNYSQKEYLKQMKRNKNSPRAKIINTDQSRAQASGGAPEFGRNKPGNEWSGVSNEWRKS
APNSIHSMNDDNEGNTQYAGQTNRGNDHGRSGYNPSYSEYGQSGAGRGGGGSGLCYNCNE
TGHMARDCPTKSQKSFGRGSKGGTSYGRGQRRGNDNDNDNGGGNNDYNSNRRNDTTDNNW
GAPRDLPPVTNDSAGGWNTGAGNDHEPMQVEPSNQGWGVTNTPGNLHAATSWDPQPAGQS
NDWGTSNDNQNEGYSPARSNRSDERGRGRGRGFGRGRGAPGGGECFKCGQSGHMARECPN
PDTRPQGGRGRGGPGGGSRACFKCNEEGHMARDCPNQDQRGDDGGRGRGRGRGRGGDDRA
CFKCQQTGHQARDCTNQDDGDRQPYKRYRREDGGSARRDDRDDNNNNDWSRRDNDKNDNN
GGGRDWDSNDRDNKQSAGKSDNWVKPADSNSQPNDQWGNTGGDNNNNNNTSSQGAWQ