Identifiers and Description

Gene Model Identifier

Contig17111.0.g19

Standard Name

SPT5a

Aliases

Contig17111_0_g19

Description

Early transcription elongation factor of RNA pol II, NGN section

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03439 ) Early transcription elongation factor of RNA pol II, NGN section
  • ( pfam00467 ) KOW motif

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYML010W4.9995619603214884e-57SPT5 SGDID:S000004470, Chr XII
I from 247677-250868, Gen...
T. thermophilaTTHERM_000285803.999374135750469e-31KOW motif family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17111.0.g19(coding)
ATGAAGAAAGAAGTACGCTACGAAGACGAGTACGATGAAGAGGAAGATGATGTCTCATAC
GAGGAGGACTACAAGAACAAAAAGAGGTCCAAGCAGACTAAGAAAGACAAAAGAAGTTCA
AAACGCTAGAAAATAGACGCTCGTAAGTTCGTTGAAGTCGAGGCCGAGGAAGCTTCAGAC
ATCGACAGCGACGAGGATCTAGACGATGAGAACGAGAAGTTGTTCAGAACTCAGCAGCAC
GAGAGTCAGTATTACACAAATGATCAACTTAAGAGAAGACAGCAAGGTATCAACATGAAC
ATGCTGCAGAGCATGGAAGAGAGGTACAGAGACACTGTCCAAGATGATAATGAGTTCGAA
GAGGATGAAGATCAAGAAGGGCTAATAGGAGAGTATGAAGGAGATGACATGCTAATCGAC
AAGGAAAAGCTTCCCTCTGTAAATGACCCCAGACTCTGGCAAGTAAGAGTGAAGAGAGGC
TGTGAAAGACAAGCAACTCTACAACTCATGAATAAAAGTATAGACTTTGCAAGAAGAGGC
AAGCACTTAAGTATCCTGTCAGTTACATGCACAGAGAAGGTAGAGGGTTTCATTTATGTT
GAGGCTTTCAAGGAGATTCACGTTAAGGAAGCAATTGTGGGGCTAAGTGTTATTCTTGGA
GGTAAATGTCTTCTTATTCAGAAAGAGGAAATGCCTGGTCTTTACTAAAATGATAAGTAA
ACCATCAATTTACAGATTCATTAGTGGGTGAGGCCAAAGCAAGGACTTTATGGTGGAGAT
TTAGGTCTAGTAGAGGCTACAGTTGATGATAAAGTTTACTTGAGACTTATTCCAAGGCTA
GATTTTAGCAAAGATCAGCTTAATGGCAAAGGTCGGGACGATAAAGCCAAGAATAAGTTC
TCCAACTAAAGACCATCTCAAAGAATCTTCAATAAGTCATTGGTACCTTAGATGAGTTTA
GAGCATAGGCAGATCCCAGCACTTGGAAACAAGACTTTTGATGTTTACAAAAAGCAGTAC
TTAAAAAATGGCTTCTTGTATAAATCTTTCCCAAGCAAGCAACTTTAGATTGACAATGTT
CGTCCAACTATTGAAGAAGTTCAATAATTTACCTCCTACATGAAGAGTTCTAAGGATGAT
ATAAATCAAATAGATGAGACTATCACTGGTGAGGAGCTAATTAGAAAGACTTTTATGCAA
GGAAGTAGTTCAGACATCAATAAAGGCGACAAGATCAGAGTGGTGAAAGGAGACTTGAAC
GGCCTCTATGGATAAGTAGTCACTATCGAAGGAAGTGATGTACTCTTTAAGCCAACTATT
GAGGGTTTCGAAGATGACCTCCGTCTACCCATGGACTTTGTTGTGAAGCACTTTGAGCCT
GGCGATCAAGTTAGAGTCATTGATGGAAAATTTAAGGGAGAGACTGGTATAGTCATTTCA
TCGGAAACTTAATTCGCTAATGTTGCATTAACTCAGAACAACAGAGAAGTCAGAATTTTT
GCTAACAGTCTTAAACTGAAATCAGAAATAGATTAAGGTGTACTTGGCATGACTGGCTAT
ATTGATAAGAAAAACTTCAGCAAATATTCAGCCAATGATTTGATCATGTATAACACTAAG
TATGTTGGAGTCGTCTTACAAGTTTAGGATGACTACTTGAAGGTAATCAATAACGAAGGT
GATCTGCAAAATATCAAGCTTTCTGATATTAACAAAAAGATTGATTTCAGTCGCAAAACC
ACTACAGTTGATTCACACAGAAACACTCTTTATGCAGATAATGTTGTAAGAATGACAAAT
GGAAAATACAAGGGAAGAAAAGGTGTAGTTAAATATATCTTCAAGACAACTTTATTCCTG
TGGGACAAAGAGTTCTATCAATCAAATGGTATCTTTGTTGAGAATGCAAGAAATGTGGTA
ATTTTAGGAGATGAACACATGAAGCAAAATTAGGGAGGTGCTGTTGCTAATTCCAATAGA
AGATTCAGAGATGTATGGGCAGGTAAAGAAATAGAAATCACTAAGGGAGAGTGGAAAGGT
TATAGAGGTAGAGTTTGCAGAGCAGATGACAGATAAGCTATAGTAGAGCTTAGTTCCAAA
TGCAGGAAAATTCCAATAGAAATCTCTCTGATCAAAGAAGTAGATGTAGGAAAGAGCGGC
ACTACTCGTGGTGACATGACTTATGGAGGCTAAACTGTTTATGAAGCTGGAAAAACTCCT
ATGCAATACAACACACCTTCATACTATCCTCATAGTCCTCATTGGGGAGCTAATCAATCA
CCAGGCTATGGAACTGACTATGACTATAACAATGCTGGCATGTCACCTGGTTTCTCAAGA
GCTGGAAGTGAGCACTATCCAAATAAACCTCAAACTCCAAGAAACGATAACTGGGTCAAG
CATGAATGA


>Contig17111.0.g19(protein)
MKKEVRYEDEYDEEEDDVSYEEDYKNKKRSKQTKKDKRSSKRQKIDARKFVEVEAEEASD
IDSDEDLDDENEKLFRTQQHESQYYTNDQLKRRQQGINMNMLQSMEERYRDTVQDDNEFE
EDEDQEGLIGEYEGDDMLIDKEKLPSVNDPRLWQVRVKRGCERQATLQLMNKSIDFARRG
KHLSILSVTCTEKVEGFIYVEAFKEIHVKEAIVGLSVILGGKCLLIQKEEMPGLYQNDKQ
TINLQIHQWVRPKQGLYGGDLGLVEATVDDKVYLRLIPRLDFSKDQLNGKGRDDKAKNKF
SNQRPSQRIFNKSLVPQMSLEHRQIPALGNKTFDVYKKQYLKNGFLYKSFPSKQLQIDNV
RPTIEEVQQFTSYMKSSKDDINQIDETITGEELIRKTFMQGSSSDINKGDKIRVVKGDLN
GLYGQVVTIEGSDVLFKPTIEGFEDDLRLPMDFVVKHFEPGDQVRVIDGKFKGETGIVIS
SETQFANVALTQNNREVRIFANSLKLKSEIDQGVLGMTGYIDKKNFSKYSANDLIMYNTK
YVGVVLQVQDDYLKVINNEGDLQNIKLSDINKKIDFSRKTTTVDSHRNTLYADNVVRMTN
GKYKGRKGVVKYIFKTTLFLWDKEFYQSNGIFVENARNVVILGDEHMKQNQGGAVANSNR
RFRDVWAGKEIEITKGEWKGYRGRVCRADDRQAIVELSSKCRKIPIEISLIKEVDVGKSG
TTRGDMTYGGQTVYEAGKTPMQYNTPSYYPHSPHWGANQSPGYGTDYDYNNAGMSPGFSR
AGSEHYPNKPQTPRNDNWVKHE